SitesBLAST
Comparing 3609567 FitnessBrowser__Dino:3609567 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q19374 Putative pyridoxal-phosphate dependent protein F13B12.4 from Caenorhabditis elegans (see 2 papers)
31% identity, 88% coverage: 34:366/380 of query aligns to 42:399/435 of Q19374
- N79 (≠ D71) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N277 (≠ S260) modified: carbohydrate, N-linked (GlcNAc...) asparagine
6c2zA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the plp-aminoacrylate intermediate (see paper)
26% identity, 82% coverage: 51:360/380 of query aligns to 17:333/345 of 6c2zA
- binding calcium ion: N180 (≠ E204), D183 (≠ P207), N184 (≠ I208)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: K50 (= K81), T78 (≠ S108), S79 (= S109), N81 (≠ S111), T82 (= T112), Q154 (= Q177), A192 (= A216), G193 (= G217), T194 (= T218), G195 (= G219), T197 (= T221), G242 (= G269), S286 (= S313), P315 (≠ C342), D316 (= D343)
6c2qA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the plp-l-serine intermediate (see paper)
26% identity, 82% coverage: 51:360/380 of query aligns to 17:333/345 of 6c2qA
- binding calcium ion: N180 (≠ E204), D183 (≠ P207), N184 (≠ I208)
- binding L-Serine, N-[[3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]-4-pyridinyl]methylene]: K50 (= K81), T78 (≠ S108), S79 (= S109), N81 (≠ S111), T82 (= T112), Q154 (= Q177), A192 (= A216), G193 (= G217), T194 (= T218), G195 (= G219), T197 (= T221), G242 (= G269), Y245 (≠ R272), S286 (= S313), P315 (≠ C342), D316 (= D343)
6c2hA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the catalytic core (see paper)
26% identity, 82% coverage: 51:360/380 of query aligns to 17:333/345 of 6c2hA
- binding calcium ion: N180 (≠ E204), D183 (≠ P207), N184 (≠ I208)
- binding pyridoxal-5'-phosphate: K50 (= K81), N81 (≠ S111), A192 (= A216), G193 (= G217), T194 (= T218), G195 (= G219), T197 (= T221), G242 (= G269), S286 (= S313), P315 (≠ C342), D316 (= D343)
6c4pA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the pmp complex (see paper)
26% identity, 82% coverage: 51:360/380 of query aligns to 16:332/344 of 6c4pA
- binding calcium ion: N179 (≠ E204), D182 (≠ P207), N183 (≠ I208)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: K49 (= K81), N80 (≠ S111), A191 (= A216), G192 (= G217), T193 (= T218), G194 (= G219), T196 (= T221), G241 (= G269), S285 (= S313), P314 (≠ C342), D315 (= D343)
6xwlC Cystathionine beta-synthase from toxoplasma gondii (see paper)
30% identity, 78% coverage: 66:360/380 of query aligns to 36:326/477 of 6xwlC
6xylA Crystal structure of delta466-491 cystathionine beta-synthase from toxoplasma gondii with l-serine (see paper)
30% identity, 78% coverage: 66:360/380 of query aligns to 36:326/468 of 6xylA
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: K51 (= K81), T82 (= T112), Q154 (= Q177), G188 (= G217), T189 (= T218), G190 (= G219), T192 (= T221), G238 (= G269), I239 (= I270), Y241 (≠ R272), S282 (= S313), P308 (≠ C342), D309 (= D343)
8b9wA Cysteine synthase from trypanosoma theileri with plp bound (see paper)
30% identity, 75% coverage: 67:351/380 of query aligns to 35:308/329 of 8b9wA
5d86A Staphyloferrin b precursor biosynthetic enzyme sbna y152f variant (see paper)
24% identity, 78% coverage: 66:360/380 of query aligns to 25:309/318 of 5d86A
- active site: K40 (= K81), S265 (= S313)
- binding magnesium ion: S225 (≠ P273), R226 (≠ I274)
- binding pyridoxal-5'-phosphate: K40 (= K81), N70 (≠ S111), V177 (≠ A216), S178 (≠ G217), T179 (= T218), T180 (≠ G219), S182 (≠ T221), G221 (= G269), S265 (= S313), P291 (≠ C342), D292 (= D343)
8b9yC Cysteine synthase from trypanosoma cruzi with plp and oas (see paper)
30% identity, 75% coverage: 67:351/380 of query aligns to 36:309/330 of 8b9yC
5d84A Staphyloferrin b precursor biosynthetic enzyme sbna bound to plp (see paper)
24% identity, 78% coverage: 66:360/380 of query aligns to 26:310/318 of 5d84A
- active site: K41 (= K81), S266 (= S313)
- binding pyridoxal-5'-phosphate: K41 (= K81), N71 (≠ S111), V178 (≠ A216), S179 (≠ G217), T180 (= T218), T181 (≠ G219), S183 (≠ T221), G222 (= G269), S266 (= S313), P292 (≠ C342), D293 (= D343)
P16703 Cysteine synthase B; CSase B; O-acetylserine (thiol)-lyase B; OAS-TL B; O-acetylserine sulfhydrylase B; EC 2.5.1.47 from Escherichia coli (strain K12) (see paper)
27% identity, 80% coverage: 47:351/380 of query aligns to 6:289/303 of P16703
- N71 (≠ S111) binding
- S255 (= S313) binding
A6QDA0 N-(2-amino-2-carboxyethyl)-L-glutamate synthase; ACEGA synthase; Staphyloferrin B biosynthesis protein SbnA; EC 2.5.1.140 from Staphylococcus aureus (strain Newman) (see paper)
24% identity, 78% coverage: 66:360/380 of query aligns to 32:316/326 of A6QDA0
- K47 (= K81) modified: N6-(pyridoxal phosphate)lysine
- N77 (≠ S111) binding
- R132 (vs. gap) mutation to A: No detectable enzyme activity. Does not form pyridoxal 5'-phosphate-alpha-aminoacrylate reaction intermediate.
- Y152 (≠ F178) mutation to F: Very low enzyme activity. Does not form pyridoxal 5'-phosphate-alpha-aminoacrylate reaction intermediate; when associated with G-185.
- STTGS 185:189 (≠ GTGGT 217:221) binding
- S272 (= S313) binding
5d85A Staphyloferrin b precursor biosynthetic enzyme sbna bound to aminoacrylate intermediate (see paper)
24% identity, 78% coverage: 66:360/380 of query aligns to 24:308/313 of 5d85A
- active site: K39 (= K81), S264 (= S313)
- binding citrate anion: S67 (= S109), K92 (≠ R134), G119 (vs. gap), Y120 (vs. gap), L121 (vs. gap), R124 (vs. gap), R216 (= R261), A223 (≠ R272), S224 (≠ P273)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: K39 (= K81), T66 (≠ S108), S67 (= S109), N69 (≠ S111), L70 (≠ T112), Q143 (= Q177), V176 (≠ A216), S177 (≠ G217), T178 (= T218), T179 (≠ G219), S181 (≠ T221), G220 (= G269), S264 (= S313), P290 (≠ C342), D291 (= D343)
3t4pA Crystal structure of o-acetyl serine sulfhydrylase from leishmania donovani in complex with designed tetrapeptide (see paper)
29% identity, 75% coverage: 67:351/380 of query aligns to 36:309/319 of 3t4pA
- active site: K50 (= K81), S273 (= S313)
- binding : S78 (= S108), S79 (= S109), G80 (= G110), T82 (= T112), M129 (= M159), Q151 (= Q177), F152 (= F178), G223 (≠ C263), P224 (≠ S264), H225 (≠ S265), G229 (= G269), G231 (= G271), P232 (≠ R272)
5b55A Crystal structure of hydrogen sulfide-producing enzyme (fn1055) d232n mutant in complexed with alpha-aminoacrylate intermediate: lysine- dimethylated form (see paper)
26% identity, 75% coverage: 67:351/380 of query aligns to 30:305/334 of 5b55A
- active site: K44 (= K81), S270 (= S313)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: K44 (= K81), T71 (≠ S108), S72 (= S109), N74 (≠ S111), T75 (= T112), Q145 (≠ E182), G180 (≠ S215), V181 (≠ A216), G182 (= G217), T183 (= T218), G184 (= G219), T186 (= T221), G227 (= G269), I228 (= I270), S270 (= S313), P296 (≠ C342), D297 (= D343)
- binding pyridoxal-5'-phosphate: K44 (= K81), N74 (≠ S111), G182 (= G217), T183 (= T218), G184 (= G219), T186 (= T221), S270 (= S313)
5z5cB Crystal structure of hydrogen sulfide-producing enzyme (fn1055) from fusobacterium nucleatum: lysine-dimethylated form (see paper)
26% identity, 75% coverage: 67:351/380 of query aligns to 33:308/336 of 5z5cB
- active site: K47 (= K81), S273 (= S313)
- binding pyridoxal-5'-phosphate: K47 (= K81), N77 (≠ S111), G185 (= G217), T186 (= T218), G187 (= G219), T189 (= T221), G230 (= G269), S273 (= S313), P299 (≠ C342), D300 (= D343)
2bhtA Crystal structure of o-acetylserine sulfhydrylase b (see paper)
27% identity, 80% coverage: 47:351/380 of query aligns to 6:289/294 of 2bhtA
- active site: K41 (= K81), S69 (= S109), Q199 (≠ D242), G203 (≠ S246), S255 (= S313), C280 (= C342)
- binding pyridoxal-5'-phosphate: K41 (= K81), N71 (≠ S111), M173 (≠ A216), G174 (= G217), T175 (= T218), T176 (≠ G219), T178 (= T221), G208 (= G255), S255 (= S313), C280 (= C342)
8if7A Crystal structure of cmnb (see paper)
30% identity, 77% coverage: 67:359/380 of query aligns to 38:319/342 of 8if7A
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: K52 (= K81), T78 (≠ S108), S79 (= S109), N81 (≠ S111), L82 (≠ T112), V188 (≠ A216), S189 (≠ G217), T190 (= T218), G191 (= G219), T193 (= T221), G232 (= G269), S276 (= S313), A302 (≠ C342), D303 (= D343)
4lmbA Crystal structure analysis of o-acetylserine sulfhydrylase cysk2 complexed with cystine from microcystis aeruginosa 7806 (see paper)
26% identity, 79% coverage: 52:351/380 of query aligns to 14:305/310 of 4lmbA
- active site: K46 (= K81), S269 (= S313)
- binding cysteine: K46 (= K81), T74 (≠ S108), S75 (= S109), N77 (≠ S111), T78 (= T112), M101 (≠ T135), M125 (= M159), M125 (= M159), Q147 (= Q177), F148 (= F178), Q224 (≠ E268), G225 (= G269), G225 (= G269), I226 (= I270), A228 (≠ R272)
- binding pyridoxal-5'-phosphate: K46 (= K81), N77 (≠ S111), V180 (≠ A216), G181 (= G217), T182 (= T218), G183 (= G219), T185 (= T221), G225 (= G269), S269 (= S313), P296 (≠ C342)
Query Sequence
>3609567 FitnessBrowser__Dino:3609567
MQGAWQGRCNGLGRRRGRGSHRVQLSAAASTRDWVAEAVRKLEADVQRSADTHLFKLELP
GLRGVDLYLKDESTHPTGSLKHRLARSLFLYALCNGQLCAGRPVIEASSGSTAVSEAYFA
QMLGLPFIAVMPRRTARSKIAEITRFGGTCHFVDSAPEMHAAATTLAAETGGYFMDQFLY
AERATDWRGNNNIAESIFRQMARERFPIPAALVMSAGTGGTSATLGRYIRYRGFETQLVV
VDPENSVFYDSYMSGDATLSRACSSRIEGIGRPIVEKSFQPDVIDTMLQVPDTASVATAL
WLSDRIGRKVGGSTGTNLWGALQIADRMQAAGTEGSIVTVMCDAGERYLDTYHDPDWVAR
EIGDIGPACAALARWDRHAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory