Comparing 3609569 FitnessBrowser__Dino:3609569 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
6czmE Crystal structure of medicago truncatula atp-phosphoribosyltransferase in tense form (see paper)
29% identity, 87% coverage: 3:209/239 of query aligns to 10:214/342 of 6czmE
Sites not aligning to the query:
2vd3A The structure of histidine inhibited hisg from methanobacterium thermoautotrophicum
29% identity, 87% coverage: 3:209/239 of query aligns to 5:190/289 of 2vd3A
Sites not aligning to the query:
5u99A Transition state analysis of adenosine triphosphate phosphoribosyltransferase (see paper)
30% identity, 85% coverage: 3:206/239 of query aligns to 4:184/278 of 5u99A
5lhtA Atp phosphoribosyltransferase from mycobacterium tuberculosis in complex with the allosteric activator 3-(2-thienyl)-l-alanine (see paper)
30% identity, 85% coverage: 3:206/239 of query aligns to 2:182/284 of 5lhtA
Sites not aligning to the query:
1nh8A Atp phosphoribosyltransferase (atp-prtase) from mycobacterium tuberculosis in complex with amp and histidine (see paper)
30% identity, 85% coverage: 3:206/239 of query aligns to 2:182/276 of 1nh8A
Sites not aligning to the query:
7dahC Adenosine triphosphate phosphoribosyltransferase from vibrio cholerae in complex with atp and prpp
27% identity, 85% coverage: 3:206/239 of query aligns to 4:193/288 of 7dahC
6czmF Crystal structure of medicago truncatula atp-phosphoribosyltransferase in tense form (see paper)
28% identity, 87% coverage: 3:209/239 of query aligns to 3:187/315 of 6czmF
Sites not aligning to the query:
5ubgA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound phosphoribosyl-atp (see paper)
33% identity, 51% coverage: 90:211/239 of query aligns to 93:198/222 of 5ubgA
Sites not aligning to the query:
5ubiA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound prpp (see paper)
33% identity, 51% coverage: 90:211/239 of query aligns to 93:198/218 of 5ubiA
Sites not aligning to the query:
1q1kA Structure of atp-phosphoribosyltransferase from e. Coli complexed with pr-atp (see paper)
26% identity, 85% coverage: 3:206/239 of query aligns to 3:192/288 of 1q1kA
1h3dA Structure of the e.Coli atp-phosphoribosyltransferase (see paper)
26% identity, 85% coverage: 3:206/239 of query aligns to 3:192/288 of 1h3dA
4yb6E Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
33% identity, 50% coverage: 93:211/239 of query aligns to 93:195/293 of 4yb6E
Sites not aligning to the query:
4yb7C Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
33% identity, 50% coverage: 93:211/239 of query aligns to 96:198/294 of 4yb7C
Sites not aligning to the query:
4yb7A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
33% identity, 50% coverage: 93:211/239 of query aligns to 96:198/296 of 4yb7A
Sites not aligning to the query:
4yb6A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
33% identity, 50% coverage: 93:211/239 of query aligns to 96:198/296 of 4yb6A
Sites not aligning to the query:
5ub9A Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni (see paper)
32% identity, 51% coverage: 90:211/239 of query aligns to 92:196/220 of 5ub9A
Sites not aligning to the query:
>3609569 FitnessBrowser__Dino:3609569
MTLKLGVPSKGRLMDKTFDWFGRHGITLQRTGSEREYAGSVDGVDGVALVLLSAGEIPRE
LAAGRIHLGVTGTDLVQEKLPDWMRQVRSIAPLGFGHADLILAVPKCWIDVETLDDLDAV
AAQFRANHGFRLRIATKYHRLVHSHLSAHGVADYQLVDSQGATEGTVANLTAEAIADITS
TGETLRANHLKILKGEPVLKSQATLFASRMADWDPTARAAMRALGAAMGRDDATDGVFQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory