SitesBLAST
Comparing 3609577 FitnessBrowser__Dino:3609577 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
35% identity, 93% coverage: 1:477/511 of query aligns to 1:476/501 of P04983
- K43 (= K43) mutation to R: Loss of transport.
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 43% coverage: 3:222/511 of query aligns to 2:220/369 of P19566
- L86 (= L90) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P163) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (≠ T168) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
34% identity, 43% coverage: 3:222/511 of query aligns to 1:219/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
34% identity, 43% coverage: 3:222/511 of query aligns to 2:220/371 of P68187
- A85 (≠ S89) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (= K109) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ I117) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V120) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ Q122) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ P127) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G140) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D161) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
34% identity, 43% coverage: 3:222/511 of query aligns to 1:219/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y14), S37 (≠ N39), G38 (= G40), C39 (≠ A41), G40 (= G42), K41 (= K43), S42 (= S44), T43 (= T45), Q81 (= Q86), R128 (= R132), A132 (≠ T136), S134 (= S138), G136 (= G140), Q137 (≠ E141), E158 (= E162), H191 (= H194)
- binding magnesium ion: S42 (= S44), Q81 (= Q86)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
34% identity, 43% coverage: 3:222/511 of query aligns to 1:219/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y14), G38 (= G40), C39 (≠ A41), G40 (= G42), K41 (= K43), S42 (= S44), T43 (= T45), R128 (= R132), S134 (= S138), Q137 (≠ E141)
- binding beryllium trifluoride ion: S37 (≠ N39), G38 (= G40), K41 (= K43), Q81 (= Q86), S134 (= S138), G136 (= G140), H191 (= H194)
- binding magnesium ion: S42 (= S44), Q81 (= Q86)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
34% identity, 43% coverage: 3:222/511 of query aligns to 1:219/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y14), V17 (≠ A19), G38 (= G40), C39 (≠ A41), G40 (= G42), K41 (= K43), S42 (= S44), T43 (= T45), R128 (= R132), A132 (≠ T136), S134 (= S138), Q137 (≠ E141)
- binding tetrafluoroaluminate ion: S37 (≠ N39), G38 (= G40), K41 (= K43), Q81 (= Q86), S134 (= S138), G135 (≠ A139), G136 (= G140), E158 (= E162), H191 (= H194)
- binding magnesium ion: S42 (= S44), Q81 (= Q86)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
34% identity, 43% coverage: 3:222/511 of query aligns to 1:219/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y14), V17 (≠ A19), G38 (= G40), C39 (≠ A41), G40 (= G42), K41 (= K43), S42 (= S44), T43 (= T45), R128 (= R132), A132 (≠ T136), S134 (= S138), Q137 (≠ E141)
- binding magnesium ion: S42 (= S44), Q81 (= Q86)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
34% identity, 43% coverage: 5:222/511 of query aligns to 1:217/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y14), S35 (≠ N39), G36 (= G40), C37 (≠ A41), G38 (= G42), K39 (= K43), S40 (= S44), T41 (= T45), R126 (= R132), A130 (≠ T136), S132 (= S138), G134 (= G140), Q135 (≠ E141)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 41% coverage: 4:215/511 of query aligns to 1:220/343 of P30750
- 40:46 (vs. 39:45, 86% identical) binding
- E166 (= E162) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
35% identity, 38% coverage: 4:197/511 of query aligns to 5:207/233 of P75957
- G42 (= G37) mutation to D: Loss of lipoprotein release when overexpressed.
7arlD Lolcde in complex with lipoprotein and adp (see paper)
35% identity, 38% coverage: 4:197/511 of query aligns to 2:204/222 of 7arlD
7mdyC Lolcde nucleotide-bound
35% identity, 38% coverage: 4:197/511 of query aligns to 2:204/226 of 7mdyC
- binding adp orthovanadate: Y12 (= Y14), G42 (= G40), S43 (≠ A41), G44 (= G42), K45 (= K43), S46 (= S44), T47 (= T45), Q91 (= Q86), H138 (≠ R132), E142 (≠ T136), S144 (= S138), G145 (≠ A139), G146 (= G140), E168 (= E162), N172 (≠ V166), H201 (= H194)
- binding magnesium ion: S46 (= S44), Q91 (= Q86)
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 41% coverage: 4:215/511 of query aligns to 2:221/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 41% coverage: 4:215/511 of query aligns to 2:221/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 41% coverage: 4:215/511 of query aligns to 2:221/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: F12 (≠ Y14), Q14 (vs. gap), I19 (≠ V17), S41 (≠ N39), G42 (= G40), A43 (= A41), G44 (= G42), K45 (= K43), S46 (= S44), T47 (= T45), N141 (≠ T136), S143 (= S138), Q146 (≠ E141), H200 (= H194)
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
35% identity, 38% coverage: 4:197/511 of query aligns to 4:206/229 of 7v8iD
- binding phosphoaminophosphonic acid-adenylate ester: V23 (vs. gap), S43 (≠ N39), G44 (= G40), G46 (= G42), K47 (= K43), S48 (= S44), T49 (= T45), Q93 (= Q86), R137 (≠ D129), H140 (≠ R132), E144 (≠ T136), S146 (= S138), G148 (= G140), E149 (= E141), H203 (= H194)
- binding magnesium ion: S48 (= S44), Q93 (= Q86)
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
32% identity, 45% coverage: 3:234/511 of query aligns to 5:241/375 of 2d62A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 43% coverage: 3:222/511 of query aligns to 1:222/235 of 6mhzA
- binding adp orthovanadate: Y12 (= Y14), N37 (= N39), G38 (= G40), G40 (= G42), K41 (= K43), T42 (≠ S44), T43 (= T45), Q84 (= Q86), S136 (≠ T136), S138 (= S138), G139 (≠ A139), G140 (= G140), E162 (= E162), G166 (≠ V166), H194 (= H194)
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 43% coverage: 3:222/511 of query aligns to 1:222/238 of 6s8nB
Query Sequence
>3609577 FitnessBrowser__Dino:3609577
MTALLRVAGLTKAYPGVVANDDVSFEIAEGEVHALLGENGAGKSTLVKMIYGLVRPDSGT
MTFGGVPFAPPEPRAARSAGVAMVFQHFSLFEALTVAENIALGMEDPPKMRDLAARITQV
SQAYGLPLDPSRLVGTLSAGERQRVEIIRCLLQEPKLLIMDEPTSVLTPQEVDILFATLR
KLRDEGTAILYISHKLEEIRALCDSATILRLGKVVATCDPREKSARELAEMMVGKTLQQT
KSAGNAFGAPVLELRGLSQPATTPFGTPLRDISLEVRAGEVLGIGGVAGNGQDELLSAIS
GERRAEDAIFLHGTPISKIGPAARRQLGVLSGPEERLGHAAAPDMSLTENALLTGSVREK
LTRNGFLDWAKTRAFAERIIETFDVRTPGPEAAARALSGGNLQKFVIGREVLQRPEVLIV
NQPTWGVDASAAAAIRQALLDLAAGGTAVVVISQDLDELMEISDTFAALNGGRLSGKVPA
AGLTVEQIGLMLGGAHDMDLPDPNAEAVLHA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory