SitesBLAST
Comparing 3609583 FitnessBrowser__Dino:3609583 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
34% identity, 100% coverage: 2:831/831 of query aligns to 3:817/824 of 4pabB
- active site: T53 (≠ P51), E102 (= E100), H226 (= H237), Y255 (= Y269), E536 (= E548)
- binding flavin-adenine dinucleotide: I11 (≠ V10), G12 (= G11), G14 (= G13), C15 (≠ A14), V16 (= V15), L35 (= L33), E36 (= E34), K37 (≠ R35), G43 (= G41), S44 (= S42), T45 (= T43), H47 (= H45), A48 (= A46), A49 (= A47), G50 (= G48), L51 (= L49), V175 (= V187), A204 (≠ T215), G205 (= G216), W207 (≠ H218), H226 (= H237), Y228 (= Y239), G326 (= G335), I328 (= I337), F353 (= F362), Y355 (≠ F364), G356 (= G365), I357 (= I366), I358 (≠ T367)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ L535), E536 (= E548), T538 (= T550), I550 (= I562), F612 (≠ W632), L613 (= L633), Y632 (= Y652), E639 (= E659), F680 (≠ Y700), Y700 (≠ R720)
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
34% identity, 100% coverage: 2:831/831 of query aligns to 40:854/857 of Q63342
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
34% identity, 98% coverage: 2:817/831 of query aligns to 47:845/866 of Q9UI17
- CV 59:60 (≠ AV 14:15) binding
- EK 80:81 (≠ ER 34:35) binding
- 87:95 (vs. 41:49, 100% identical) binding
- H91 (= H45) modified: Tele-8alpha-FAD histidine
- H109 (= H63) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V173) binding
- S279 (≠ V249) to P: in dbSNP:rs532964
- FGYGII 397:402 (≠ FSFGIT 362:367) binding
- A530 (≠ G498) to G: in dbSNP:rs1805073
- S646 (≠ R617) to P: in dbSNP:rs1805074
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
30% identity, 100% coverage: 1:828/831 of query aligns to 22:823/824 of Q8GAI3
- W66 (= W44) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (= H45) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
30% identity, 100% coverage: 1:828/831 of query aligns to 1:829/830 of Q9AGP8
- IV 14:15 (≠ AV 14:15) binding
- DQ 35:36 (≠ ER 34:35) binding
- STSH 45:48 (≠ STWH 42:45) binding
- L52 (= L49) binding
- V174 (= V187) binding
- H225 (= H237) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (= Y269) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- VWVT 360:363 (≠ FGIT 364:367) binding
- Y539 (≠ L535) binding
- D552 (≠ E548) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
30% identity, 99% coverage: 6:828/831 of query aligns to 3:826/827 of 1pj7A
- active site: H222 (= H237), Y256 (= Y269), D549 (≠ E548)
- binding flavin-adenine dinucleotide: G8 (= G11), G10 (= G13), I11 (≠ A14), V12 (= V15), D32 (≠ E34), Q33 (≠ R35), G41 (= G41), S42 (= S42), T43 (= T43), H45 (= H45), P47 (≠ A47), L49 (= L49), T170 (= T186), V171 (= V187), A200 (≠ T215), G201 (= G216), W203 (≠ H218), H222 (= H237), Y256 (= Y269), I331 (≠ P336), V357 (≠ F364), W358 (≠ G365), V359 (≠ I366), T360 (= T367)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (≠ F505), Y536 (≠ L535), D549 (≠ E548), T551 (= T550), G563 (= G565), F629 (≠ L633), Y648 (= Y652), E655 (= E659), Y696 (= Y700)
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
30% identity, 99% coverage: 6:828/831 of query aligns to 4:827/828 of 1pj6A
- active site: H223 (= H237), Y257 (= Y269), D550 (≠ E548)
- binding flavin-adenine dinucleotide: G9 (= G11), G11 (= G13), I12 (≠ A14), V13 (= V15), D33 (≠ E34), Q34 (≠ R35), G42 (= G41), S43 (= S42), T44 (= T43), H46 (= H45), P48 (≠ A47), L50 (= L49), V172 (= V187), A201 (≠ T215), G202 (= G216), W204 (≠ H218), H223 (= H237), Y257 (= Y269), G331 (= G335), I332 (≠ P336), V358 (≠ F364), W359 (≠ G365), V360 (≠ I366), T361 (= T367)
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
30% identity, 99% coverage: 6:828/831 of query aligns to 3:826/827 of 3gsiA
- active site: H222 (= H237), Y256 (= Y269), A549 (≠ E548)
- binding flavin-adenine dinucleotide: G10 (= G13), I11 (≠ A14), V12 (= V15), D32 (≠ E34), Q33 (≠ R35), G41 (= G41), S42 (= S42), T43 (= T43), H45 (= H45), P47 (≠ A47), L49 (= L49), T170 (= T186), V171 (= V187), A200 (≠ T215), G201 (= G216), W203 (≠ H218), H222 (= H237), Y256 (= Y269), G330 (= G335), I331 (≠ P336), F332 (≠ I337), V357 (≠ F364), W358 (≠ G365), V359 (≠ I366), T360 (= T367)
- binding magnesium ion: D254 (≠ K267), V409 (≠ A415)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (≠ F505), Y536 (≠ L535), T551 (= T550), G563 (= G565), F629 (≠ L633), Y648 (= Y652), E655 (= E659), Y696 (= Y700)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 43% coverage: 433:791/831 of query aligns to 1:327/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 43% coverage: 433:791/831 of query aligns to 1:327/362 of 1wopA
- active site: D96 (≠ E548)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ F505), L55 (≠ R509), Y83 (≠ L535), D96 (≠ E548), V98 (≠ T550), E106 (≠ D558), L108 (≠ T560), V110 (≠ I562), N112 (≠ A564), I137 (≠ T594), E160 (≠ R617), Y168 (≠ L625), Y169 (≠ S626), K173 (≠ R636), S174 (≠ E637), I175 (= I638), E180 (≠ C643), T181 (≠ P644), Y188 (= Y652), E195 (= E659), M197 (≠ H661), R227 (≠ Q691), Y236 (= Y700)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 43% coverage: 433:791/831 of query aligns to 1:327/362 of 1wooA
- active site: D96 (≠ E548)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ F505), Y83 (≠ L535), D96 (≠ E548), V98 (≠ T550), V110 (≠ I562), N112 (≠ A564), Y168 (≠ L625), Y169 (≠ S626), Y188 (= Y652), E195 (= E659), Y236 (= Y700)
Sites not aligning to the query:
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
27% identity, 48% coverage: 432:831/831 of query aligns to 575:967/967 of Q46337
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 139 G→A: Does not affect activity and binding of NAD(+).
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
25% identity, 48% coverage: 432:831/831 of query aligns to 573:965/965 of Q50LF0
Sites not aligning to the query:
- 139 binding
- 158 binding
- 159 binding
- 160 binding
- 166 binding
- 205 binding
- 418 binding
- 423 binding
- 425 binding
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
26% identity, 48% coverage: 432:831/831 of query aligns to 573:965/965 of 2gagA
Sites not aligning to the query:
- active site: 350, 375
- binding flavin mononucleotide: 510, 511, 517, 521, 549, 551
- binding nicotinamide-adenine-dinucleotide: 134, 135, 137, 138, 139, 158, 159, 160, 165, 166, 204, 205, 249, 250, 295, 381, 417, 418, 423, 424, 425, 554
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
25% identity, 47% coverage: 432:825/831 of query aligns to 572:960/963 of 3ad7A
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
25% identity, 47% coverage: 432:825/831 of query aligns to 572:960/963 of 1vrqA
- active site: D676 (≠ E548)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (≠ F505), Y663 (≠ L535), G677 (≠ Y549), H690 (≠ I562), I774 (≠ V650), F776 (≠ Y652), E783 (= E659), K822 (= K698), F824 (≠ Y700)
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
24% identity, 45% coverage: 20:397/831 of query aligns to 20:368/374 of 1y56B
- active site: F44 (≠ W44), G47 (vs. gap), T48 (≠ A47), H224 (= H237), P239 (= P256), G305 (= G335), M338 (≠ T367)
- binding flavin-adenine dinucleotide: I33 (≠ L33), E34 (= E34), K35 (≠ R35), S42 (= S42), T43 (= T43), R45 (≠ H45), C46 (≠ A46), G47 (vs. gap), G49 (= G48), E170 (≠ Q172), V171 (= V173), T200 (= T215), N201 (≠ G216), W203 (≠ H218), G305 (= G335), Y306 (≠ P336), Y307 (≠ I337), G334 (vs. gap), H335 (≠ F364), G336 (= G365), F337 (≠ I366), M338 (≠ T367)
- binding flavin mononucleotide: F44 (≠ W44), R45 (≠ H45), I260 (≠ P287), R301 (≠ D331), W303 (≠ Y333)
Sites not aligning to the query:
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
24% identity, 48% coverage: 428:824/831 of query aligns to 21:398/403 of P48728
- D129 (≠ E548) mutation D->A,N: Loss of aminomethyltransferase activity.
- N145 (≠ S563) to I: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs386833682
- E232 (= E659) binding
- R261 (≠ Q691) binding
- G269 (≠ S699) to D: in GCE2; decreased aminomethyltransferase activity; dbSNP:rs121964981
- R320 (≠ C743) to H: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs121964985
Sites not aligning to the query:
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
24% identity, 47% coverage: 433:824/831 of query aligns to 2:367/371 of 1wsvA
- active site: D98 (≠ E548)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: M53 (≠ F505), L85 (= L535), D98 (≠ E548), L99 (≠ Y549), I100 (≠ T550), V112 (≠ L561), N114 (≠ S563), F173 (≠ W632), G193 (≠ A651), Y194 (= Y652), E201 (= E659), R230 (≠ Q691), L239 (≠ Y700)
Sites not aligning to the query:
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
23% identity, 46% coverage: 2:384/831 of query aligns to 17:374/403 of 2gagB
- active site: A61 (≠ W44), T64 (≠ A47), T65 (≠ G48)
- binding flavin-adenine dinucleotide: G26 (= G11), G28 (= G13), G29 (≠ A14), H30 (≠ V15), E51 (= E34), K52 (≠ R35), G58 (= G41), N59 (≠ S42), M60 (≠ T43), R62 (≠ H45), N63 (≠ A46), T64 (≠ A47), I66 (≠ L49), V195 (= V173), G224 (≠ T215), A225 (≠ G216), H227 (= H218), L231 (≠ T222), L246 (≠ D245), G352 (vs. gap), T353 (≠ S363), G354 (≠ F364), G355 (= G365), F356 (≠ I366), K357 (≠ T367)
- binding flavin mononucleotide: A61 (≠ W44), R62 (≠ H45), H171 (≠ P149), V250 (= V249), E278 (≠ G276), R321 (≠ D331), W323 (≠ Y333)
- binding 2-furoic acid: T64 (≠ A47), I66 (≠ L49), R68 (≠ P51), M263 (≠ L261), Y270 (≠ W268), K357 (≠ T367)
- binding sulfite ion: K170 (≠ N148), K276 (≠ R274)
Sites not aligning to the query:
Query Sequence
>3609583 FitnessBrowser__Dino:3609583
MKTQVKALVVGGGAVGTGIAYHLGKAGWDVLLLERDELTSGSTWHAAGLLPLFNMSYATS
HIHDYSVKFYKGLEAETGLNPGFAVVGNLRMAQTQARMDEYMLYAATAETVGIPHEWLTP
AQIRDRYPLVRTEDLKGAILHPTDGYINPADVTQAMAKGARQHGVAIERKWQVDAYAWQG
DHWAVTVTKMADRGGNLVPTDEQQVIRAEHVVTATGNHAQRTAQLLGIKIPAIPVEHQYI
VTEPDPALVQWRKDNPEHPVLRDADAKWYVREERGGWILGPYEQGAPARFKYAVPESFRA
DLFPLDLERIEEEYMSMIHRIPTSETVGLKDDYNGPICYTPDGNPLVGPAPGLRNMWLAE
GFSFGITAAGGTGYYLAQMMTEGEAEIDMASLDPRRYGSWMTTEYAATKNEECYAHVFIL
HHPDEERAACRPLRTTPAYDRQKALGAQFGQVNGWERPNYYGPLDAPDNFDHDARSFRRG
GWWDYARAEAEAVRSTAGLIDATAFAKHRVSGPGATAFLDWFTTNTLPRVGRINLTYALT
GAGTTHTEYTILRTGEDDYTLISAGAWHAYDQDFLTKAIEDTEPRFGRITLQDTTTQTGV
FALAGPKARDILKALIRDPDPETALSNKRFPWLGTREIELGMCPLRAVRVAYTGALGWEL
HHPIEMQTYLWDQLMAVGAAHGLKPVGARAQNWLRQEKSYRAFGTELGRDATPLEAGLDR
FVDLSKDFHGKAAMVETGIRSRCVTLLIDGPDDADPWGREALYAGDTRVGRLTSGGYSVA
FGKSIAMGYVTPDHAAPGTKLKVRMFNALWDAEVTEDSPFDPQNATIRADG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory