Comparing 3609625 FitnessBrowser__Dino:3609625 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
38% identity, 47% coverage: 5:276/576 of query aligns to 4:277/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
38% identity, 47% coverage: 5:273/576 of query aligns to 3:274/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
31% identity, 49% coverage: 5:287/576 of query aligns to 3:286/330 of P0AAH4
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
30% identity, 43% coverage: 286:531/576 of query aligns to 7:231/353 of 1vciA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
31% identity, 44% coverage: 282:533/576 of query aligns to 3:247/375 of 2d62A
8hprD Lpqy-sugabc in state 4 (see paper)
35% identity, 41% coverage: 291:524/576 of query aligns to 8:229/362 of 8hprD
8hprC Lpqy-sugabc in state 4 (see paper)
35% identity, 41% coverage: 291:524/576 of query aligns to 8:229/363 of 8hprC
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 40% coverage: 289:520/576 of query aligns to 7:232/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 40% coverage: 289:520/576 of query aligns to 7:232/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 40% coverage: 289:520/576 of query aligns to 7:232/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
32% identity, 40% coverage: 289:520/576 of query aligns to 7:232/353 of Q97UY8
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 44% coverage: 4:257/576 of query aligns to 1:244/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 44% coverage: 4:257/576 of query aligns to 1:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 44% coverage: 4:257/576 of query aligns to 1:244/344 of 3tuiC
1g291 Malk (see paper)
31% identity, 44% coverage: 290:543/576 of query aligns to 8:262/372 of 1g291
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
34% identity, 41% coverage: 291:524/576 of query aligns to 8:227/384 of 8hplC
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
32% identity, 40% coverage: 26:258/576 of query aligns to 20:247/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
32% identity, 40% coverage: 26:258/576 of query aligns to 20:247/250 of 7z18I
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 42% coverage: 284:524/576 of query aligns to 16:243/378 of P69874
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 44% coverage: 5:257/576 of query aligns to 1:243/343 of P30750
Sites not aligning to the query:
>3609625 FitnessBrowser__Dino:3609625
MNKHVLELTDLSIDFPTARGVVHAVTKLSLNIRPGIRVGFIGESGSGKTTTALSVMRMLG
GSGRVAEGAIRLGETDILALSEEEMRLTRLSRVSYIPQGAMNSLNPIMRIENQIWDGIVA
HEGKTDAATLKARSNACLESVGLPARTGRLYPHELSGGMKQRVCIALGVSLNPELIIADE
PTSALDVVTQRHVMQTLKDVQARIGSGLILIGHDMGLMAQSVDELAVLKDGVLVEHGTVK
QILEAPKHPYTRQLISSVPLVGGDSFLDPQVGAPPARRGKEGVPLLEFKSVSKTYGDVTA
LHPMSFALDGETPKIISIVGQSGSGKSTMGSLMLGFNPPSTGQVLFEGEDIAKHSAADRL
EFRKNVQAVFQDPYACFNPFYRVDHALKFPYKRLGLGTSDDEIEAKMLEACEAVGLDGAL
ILRRFPHELSGGQRQRLIVARALMLSPKLLIADEPVSMVDASLRATILKNIYDLKDRYGI
SILYITHDLATAYHVSDYVMVLYHGHVVEAGPPKQVIGDPQHPYTRMLIEAIPWPDVSRD
WGEADEASDAARLAEIARATETVIRGEIPGFTLAAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory