Comparing 3609633 FitnessBrowser__Dino:3609633 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
Q9Y315 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Homo sapiens (Human) (see paper)
61% identity, 90% coverage: 30:334/339 of query aligns to 5:313/318 of Q9Y315
5el1A Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) after acetaldehyde treatment (see paper)
40% identity, 70% coverage: 73:310/339 of query aligns to 7:234/248 of 5el1A
Sites not aligning to the query:
5ekyA Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) (see paper)
40% identity, 70% coverage: 73:310/339 of query aligns to 7:234/248 of 5ekyA
Sites not aligning to the query:
6z9iB Escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant complex with reaction products (see paper)
39% identity, 70% coverage: 73:310/339 of query aligns to 7:234/248 of 6z9iB
Sites not aligning to the query:
P0A6L0 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 70% coverage: 73:310/339 of query aligns to 9:236/259 of P0A6L0
Sites not aligning to the query:
1jcjA Observation of covalent intermediates in an enzyme mechanism at atomic resolution (see paper)
39% identity, 70% coverage: 73:310/339 of query aligns to 10:237/252 of 1jcjA
Sites not aligning to the query:
7p76A Re-engineered 2-deoxy-d-ribose-5-phosphate aldolase catalysing asymmetric michael addition reactions, schiff base complex with cinnamaldehyde (see paper)
37% identity, 74% coverage: 73:324/339 of query aligns to 6:247/247 of 7p76A
8forA Crystal structure of kemp eliminase ke70-core with bound transition state analogue
35% identity, 70% coverage: 73:310/339 of query aligns to 6:234/249 of 8forA
3q2dA Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution (see paper)
35% identity, 70% coverage: 73:310/339 of query aligns to 3:232/246 of 3q2dA
Q4ZMV1 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Pseudomonas syringae pv. syringae (strain B728a) (see paper)
33% identity, 60% coverage: 79:280/339 of query aligns to 13:191/226 of Q4ZMV1
3ngjD Crystal structure of a putative deoxyribose-phosphate aldolase from entamoeba histolytica
30% identity, 63% coverage: 79:291/339 of query aligns to 14:203/222 of 3ngjD
Sites not aligning to the query:
1ub3A Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8 (see paper)
32% identity, 45% coverage: 148:298/339 of query aligns to 60:202/211 of 1ub3A
Sites not aligning to the query:
3qyqA 1.8 angstrom resolution crystal structure of a putative deoxyribose- phosphate aldolase from toxoplasma gondii me49 (see paper)
29% identity, 51% coverage: 137:310/339 of query aligns to 70:253/273 of 3qyqA
Sites not aligning to the query:
>3609633 FitnessBrowser__Dino:3609633
MSSTPTDTTTTGQQIDLHRGHLPDTVLPRNPGLPLDLDWVRSAAVNTSAVERRAASLPGR
RSVKKDHQAAWLLKAVTLIDLTTLAGDDTAGRVRRLCAKARQPVAPEVLAALGMGPVTTG
AVCVYHDMVHVAVEALEGSGIPVAAVSTGFPAGLSPFHLRVAEIEESVAAGAAEIDIVIS
RRHVLTGNWQALYDEMRAFRAACGDAHVKAILATGELGDLGNVARASLVCMMAGADFIKT
STGKESVNATLPVSLVMIRAIRDYEAATGVKVGYKPAGGISKAKDALVYLSLIKEELGDR
WLQPDLFRFGASSLLGDIERQLEHHVTGAYSATHRHALG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory