Comparing 3609637 FitnessBrowser__Dino:3609637 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 93% coverage: 12:411/431 of query aligns to 4:369/383 of 7uoiA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
26% identity, 96% coverage: 10:424/431 of query aligns to 1:379/380 of 5vo3A
7lgpB Dape enzyme from shigella flexneri
26% identity, 96% coverage: 12:424/431 of query aligns to 1:376/377 of 7lgpB
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
25% identity, 95% coverage: 15:424/431 of query aligns to 2:375/377 of P44514
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
26% identity, 90% coverage: 39:424/431 of query aligns to 23:375/377 of 7t1qA
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
26% identity, 94% coverage: 19:424/431 of query aligns to 6:375/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
26% identity, 94% coverage: 21:424/431 of query aligns to 8:375/376 of 4o23A
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
34% identity, 41% coverage: 12:189/431 of query aligns to 1:166/258 of 4h2kA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
25% identity, 84% coverage: 19:381/431 of query aligns to 13:355/407 of P37111
Sites not aligning to the query:
7rsfA Acetylornithine deacetylase from escherichia coli
26% identity, 85% coverage: 40:404/431 of query aligns to 31:358/380 of 7rsfA
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
33% identity, 40% coverage: 18:189/431 of query aligns to 5:164/265 of 4op4B
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
27% identity, 59% coverage: 19:271/431 of query aligns to 13:259/408 of Q03154
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
27% identity, 46% coverage: 75:272/431 of query aligns to 85:277/426 of 3pfoA
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
28% identity, 44% coverage: 19:207/431 of query aligns to 7:192/192 of 1q7lA
1cg2A Carboxypeptidase g2 (see paper)
28% identity, 42% coverage: 44:226/431 of query aligns to 44:216/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
28% identity, 42% coverage: 44:226/431 of query aligns to 69:241/415 of P06621
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
30% identity, 37% coverage: 88:246/431 of query aligns to 95:249/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
30% identity, 37% coverage: 88:246/431 of query aligns to 126:282/507 of Q96KN2
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
30% identity, 32% coverage: 103:242/431 of query aligns to 110:260/475 of Q96KP4
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
29% identity, 32% coverage: 103:242/431 of query aligns to 110:260/475 of Q9D1A2
Sites not aligning to the query:
>3609637 FitnessBrowser__Dino:3609637
MPDETSLTDAVSARRADLVALTRDLIRIPTLNPPGRHYHDICAFLEARLAPLGFRCELVR
ATGAPADSERYPRWNLVARYEGGGPGDCVHFNSHHDVVEVGHGWTMDPFGGEVRDGRVYG
RGACDMKGGLAASVIAAEAFIATHPEFSGAIEISATADEESGGFGGVAYLAEQGWFSPER
VQHVIIPEPLNKDRICLGHRGVWWAEVETKGRIAHGSMPFLGDSAIRHMGAVLHEIETVL
YPLLATKRTKMPVVPEGARQSTLNINSVHGGEPEQDADYTGLPAPCVADRCRIVLDRRFL
IEEDITEVKAEITALLERVKATRPSFEYEIRELFEVQPTMADRDAPVVRSVAASIERVLA
RQPDYVVSPGTYDQKHIDRIGRLKNCIAYGPGILDLAHQPDEWVGIDDMVDSAKVMALTL
QDLLVVPQPGS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory