Comparing 3609667 Dshi_3050 Citrate (pro-3S)-lyase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3J5L6 L-malyl-CoA/beta-methylmalyl-CoA lyase; (3S)-malyl-CoA/beta-methylmalyl-CoA lyase; (S)-citramalyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
88% identity, 99% coverage: 1:316/318 of query aligns to 1:316/318 of Q3J5L6
4l9yC Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
88% identity, 99% coverage: 2:316/318 of query aligns to 1:315/316 of 4l9yC
4l9yA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
88% identity, 99% coverage: 2:315/318 of query aligns to 1:314/314 of 4l9yA
4l9zA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa (see paper)
88% identity, 98% coverage: 3:315/318 of query aligns to 1:313/313 of 4l9zA
5ugrA Malyl-coa lyase from methylobacterium extorquens (see paper)
55% identity, 100% coverage: 2:318/318 of query aligns to 1:322/323 of 5ugrA
4l80C Crystal structure of chloroflexus aurantiacus malyl-coa lyase in complex with magnesium, oxalate, and propionyl-coa (see paper)
37% identity, 97% coverage: 10:316/318 of query aligns to 23:334/347 of 4l80C
S5N020 Malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; (3S)-citramalyl-CoA pyruvate-lyase; (S)-citramalyl-CoA lyase; Erythro-beta-methylmalyl-CoA; L-malyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Chloroflexus aurantiacus (see paper)
37% identity, 97% coverage: 10:316/318 of query aligns to 24:335/348 of S5N020
Q8N0X4 Citramalyl-CoA lyase, mitochondrial; (3S)-malyl-CoA thioesterase; Beta-methylmalate synthase; Citrate lyase subunit beta-like protein; Citrate lyase beta-like; Malate synthase; EC 4.1.3.25; EC 3.1.2.30; EC 2.3.3.-; EC 2.3.3.9 from Homo sapiens (Human) (see 5 papers)
29% identity, 94% coverage: 13:311/318 of query aligns to 44:332/340 of Q8N0X4
Sites not aligning to the query:
5vxoA Crystal structure analysis of human clybl in complex with propionyl- coa (see paper)
29% identity, 94% coverage: 13:311/318 of query aligns to 5:293/298 of 5vxoA
5vxcA Crystal structure analysis of human clybl in complex with free coash (see paper)
29% identity, 94% coverage: 13:311/318 of query aligns to 5:293/301 of 5vxcA
Q9RUZ0 Citrate lyase subunit beta-like protein; EC 4.1.-.- from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
28% identity, 96% coverage: 9:312/318 of query aligns to 3:282/284 of Q9RUZ0
1sgjB Crystal structure of citrate lyase beta subunit
28% identity, 78% coverage: 15:263/318 of query aligns to 6:230/231 of 1sgjB
1sgjA Crystal structure of citrate lyase beta subunit
28% identity, 78% coverage: 15:263/318 of query aligns to 6:230/231 of 1sgjA
6aq4C Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
32% identity, 93% coverage: 18:313/318 of query aligns to 11:267/267 of 6aq4C
6arbA Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and coenzyme a (see paper)
31% identity, 93% coverage: 18:313/318 of query aligns to 10:266/268 of 6arbA
6aq4B Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
32% identity, 93% coverage: 18:313/318 of query aligns to 11:267/268 of 6aq4B
6as5A Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, acetoacetate and coenzyme a (see paper)
32% identity, 93% coverage: 18:313/318 of query aligns to 9:265/267 of 6as5A
3r4iA Crystal structure of a citrate lyase (bxe_b2899) from burkholderia xenovorans lb400 at 2.24 a resolution
27% identity, 88% coverage: 39:317/318 of query aligns to 43:310/321 of 3r4iA
3oyxA Haloferax volcanii malate synthase magnesium/glyoxylate complex (see paper)
23% identity, 77% coverage: 35:278/318 of query aligns to 38:284/348 of 3oyxA
3oyzA Haloferax volcanii malate synthase pyruvate/acetyl-coa ternary complex (see paper)
23% identity, 71% coverage: 35:260/318 of query aligns to 38:264/376 of 3oyzA
Sites not aligning to the query:
>3609667 Dshi_3050 Citrate (pro-3S)-lyase (RefSeq)
MSFRLQPPAPARPNRCQLFGPGSRPAIFEKMAASAADVINLDLEDSVAPDDKAQARKNVI
QAIGDVDWGKKTLSVRINSLDTPFWYRDVVDLMEQAGERLDQIMIPKVGCAEDIYAVDAL
VTAAEAAAGRTRKISFEVIIESAAGIAHVEDIAAASPRLQAMSLGAADFAASMGMQTTGI
GGTQENYYMLHEGAKHWSDPWHWAQAAIVAACRTHGVLPVDGPFGDFSDDEGFRAQARRS
ATLGMVGKWAIHPKQVAIANEVFTPSAEAVAEAREILAAMEQAKANGEGATVYKGRLVDI
ASIKQAEVIVAQSELIGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory