Comparing 3609760 Dshi_3143 binding-protein-dependent transport systems inner membrane component (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
29% identity, 99% coverage: 3:289/290 of query aligns to 6:277/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
27% identity, 90% coverage: 8:268/290 of query aligns to 33:288/313 of P94529
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
31% identity, 77% coverage: 50:273/290 of query aligns to 245:481/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
31% identity, 77% coverage: 50:273/290 of query aligns to 260:496/514 of P02916
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
25% identity, 77% coverage: 2:223/290 of query aligns to 7:224/296 of P68183
>3609760 Dshi_3143 binding-protein-dependent transport systems inner membrane component (RefSeq)
MRDNTLKYFLVLPAVVVVFATAIWPLIEAARMSFTVGRLNRPGSLEQYIGWENYAWAFFE
EPAFWNSVYVTALYTVVTVGLTTLLALGLALLLAPGGRLRVSAQTLLILPFAMSPALIGV
SFRFMFNPEFGLFDAFFGVMIPPLADVSWLADPTLAFAVVVMADVWGWIPFLTLVLIGGL
ASVPRDTIEAAQVDGASSWRVFRDVTLPQLGPVLAVVIILKSIFSLKTFDQVFMLTNGGP
GTATQTLSHYIYFNGMKYGQIGYSASVAWLMVIPMIFLTYAYAKFVFRKN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory