SitesBLAST
Comparing 3609767 FitnessBrowser__Dino:3609767 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
36% identity, 94% coverage: 8:275/284 of query aligns to 6:272/280 of 3lqsA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K147), E177 (= E179), L201 (= L204)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (= V35), R50 (= R52), E177 (= E179), S180 (= S182), S181 (≠ N183), N182 (= N184), L201 (= L204), G203 (= G206), I204 (= I207), T205 (= T208), S240 (= S243), T241 (≠ A244), T242 (≠ S245)
3daaA Crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine (see paper)
36% identity, 94% coverage: 8:275/284 of query aligns to 6:272/277 of 3daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K147), E177 (= E179), L201 (= L204)
- binding n-(5'-phosphopyridoxyl)-d-alanine: Y31 (= Y33), R50 (= R52), K145 (= K147), E177 (= E179), S180 (= S182), S181 (≠ N183), L201 (= L204), G203 (= G206), I204 (= I207), T205 (= T208), S240 (= S243), T241 (≠ A244)
2daaA Crystallographic structure of d-amino acid aminotransferase inactivated by d-cycloserine
36% identity, 94% coverage: 8:275/284 of query aligns to 6:272/277 of 2daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K147), E177 (= E179), L201 (= L204)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Y31 (= Y33), V33 (= V35), R50 (= R52), R98 (= R100), H100 (≠ F102), K145 (= K147), E177 (= E179), S180 (= S182), S181 (≠ N183), N182 (= N184), L201 (= L204), G203 (= G206), I204 (= I207), T205 (= T208), T241 (≠ A244)
1daaA Crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate (see paper)
36% identity, 94% coverage: 8:275/284 of query aligns to 6:272/277 of 1daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K147), E177 (= E179), L201 (= L204)
- binding pyridoxal-5'-phosphate: R50 (= R52), K145 (= K147), E177 (= E179), S180 (= S182), S181 (≠ N183), L201 (= L204), G203 (= G206), I204 (= I207), T205 (= T208), S240 (= S243), T241 (≠ A244)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
36% identity, 94% coverage: 8:275/284 of query aligns to 7:273/283 of P19938
- Y32 (= Y33) binding
- R51 (= R52) binding
- R99 (= R100) binding
- H101 (≠ F102) binding
- K146 (= K147) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (= E179) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (= L204) mutation to A: Inactivates enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1a0gB L201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate (see paper)
36% identity, 94% coverage: 8:275/284 of query aligns to 6:272/282 of 1a0gB
- active site: Y31 (= Y33), V33 (= V35), K145 (= K147), E177 (= E179), A201 (≠ L204)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R50 (= R52), K145 (= K147), E177 (= E179), S180 (= S182), S181 (≠ N183), G203 (= G206), I204 (= I207), T205 (= T208), S240 (= S243), T241 (≠ A244)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
31% identity, 99% coverage: 4:284/284 of query aligns to 4:287/290 of 5e25A
- active site: F33 (≠ Y33), G35 (≠ V35), K151 (= K147), E184 (= E179), L207 (= L204)
- binding 2-oxoglutaric acid: Y88 (≠ L88), K151 (= K147), T247 (≠ A244), A248 (≠ S245)
- binding pyridoxal-5'-phosphate: R52 (= R52), K151 (= K147), Y155 (≠ L151), E184 (= E179), G187 (≠ S182), D188 (≠ N183), L207 (= L204), G209 (= G206), I210 (= I207), T211 (= T208), G246 (≠ S243), T247 (≠ A244)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
31% identity, 95% coverage: 5:273/284 of query aligns to 4:275/290 of 5mr0D
- active site: F32 (≠ Y33), G34 (≠ V35), K150 (= K147), E183 (= E179), L206 (= L204)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R52), G100 (≠ D101), L101 (≠ F102), K150 (= K147), Y154 (≠ L151), E183 (= E179), G186 (≠ S182), D187 (≠ N183), L206 (= L204), I209 (= I207), T210 (= T208), G245 (≠ S243), T246 (≠ A244)
7p3tB Transaminase of gamma-proteobacterium (see paper)
32% identity, 96% coverage: 4:275/284 of query aligns to 5:279/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R52), K153 (= K147), R157 (≠ L151), E186 (= E179), S187 (≠ G180), A188 (≠ T181), A189 (≠ S182), S190 (≠ N183), G210 (= G206), I211 (= I207), T212 (= T208), T248 (≠ A244)
6snlD (R)-selective amine transaminase from exophiala sideris (see paper)
29% identity, 96% coverage: 4:275/284 of query aligns to 28:304/320 of 6snlD
- active site: Y57 (= Y33), K178 (≠ V149), E211 (= E179), L233 (= L204)
- binding pyridoxal-5'-phosphate: R76 (= R52), K178 (≠ V149), E211 (= E179), G214 (≠ S182), F215 (≠ N183), L233 (= L204), G235 (= G206), V236 (≠ I207), T237 (= T208), T273 (≠ A244)
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
28% identity, 96% coverage: 4:275/284 of query aligns to 17:291/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (≠ Y33), R65 (= R52), N166 (≠ Q139), S202 (≠ N183), T203 (≠ N184), F222 (≠ L204), G224 (= G206), I225 (= I207), T226 (= T208), G261 (≠ S243), T262 (≠ A244)
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
29% identity, 96% coverage: 4:277/284 of query aligns to 6:288/305 of 2ej0B
- active site: F35 (≠ Y33), G37 (vs. gap), K158 (vs. gap), E192 (= E179), L215 (= L204)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R52), Y163 (≠ L151), E192 (= E179), G195 (≠ S182), E196 (≠ N183), L215 (= L204), G217 (= G206), I218 (= I207), T219 (= T208), G254 (≠ S243), T255 (≠ A244)
2ej2A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
29% identity, 96% coverage: 4:277/284 of query aligns to 6:277/294 of 2ej2A
- active site: F35 (≠ Y33), G37 (vs. gap), K147 (vs. gap), E181 (= E179), L204 (= L204)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: R58 (= R52), Y94 (≠ A98), Y152 (vs. gap), E181 (= E179), G184 (≠ S182), E185 (≠ N183), L204 (= L204), G206 (= G206), I207 (= I207), T208 (= T208), T244 (≠ A244), A245 (≠ S245)
4ce5B First crystal structure of an (r)-selective omega-transaminase from aspergillus terreus (see paper)
27% identity, 96% coverage: 4:275/284 of query aligns to 31:306/325 of 4ce5B
- active site: Y60 (= Y33), K180 (≠ V149), E213 (= E179), L235 (= L204)
- binding calcium ion: D67 (≠ G40), R69 (≠ K42)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: V62 (= V35), R79 (= R52), K180 (≠ V149), W184 (≠ Y153), E213 (= E179), G216 (≠ S182), F217 (≠ N183), N218 (= N184), L235 (= L204), G237 (= G206), V238 (≠ I207), T239 (= T208), T274 (≠ S243), T275 (≠ A244), A276 (≠ S245)
- binding pyridoxal-5'-phosphate: R79 (= R52), K180 (≠ V149), E213 (= E179), G216 (≠ S182), F217 (≠ N183), L235 (= L204), G237 (= G206), V238 (≠ I207), T239 (= T208), T275 (≠ A244)
4ce5A First crystal structure of an (r)-selective omega-transaminase from aspergillus terreus (see paper)
27% identity, 96% coverage: 4:275/284 of query aligns to 31:306/325 of 4ce5A
- active site: Y60 (= Y33), K180 (≠ V149), E213 (= E179), L235 (= L204)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: Y60 (= Y33), V62 (= V35), R79 (= R52), K180 (≠ V149), W184 (≠ Y153), E213 (= E179), G216 (≠ S182), F217 (≠ N183), N218 (= N184), L235 (= L204), G237 (= G206), V238 (≠ I207), T239 (= T208), T274 (≠ S243), T275 (≠ A244)
- binding pyridoxal-5'-phosphate: R79 (= R52), K180 (≠ V149), E213 (= E179), F217 (≠ N183), L235 (= L204), G237 (= G206), V238 (≠ I207), T239 (= T208), T275 (≠ A244)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
29% identity, 96% coverage: 4:277/284 of query aligns to 6:280/297 of 2ej3A
- active site: F35 (≠ Y33), G37 (vs. gap), K150 (vs. gap), E184 (= E179), L207 (= L204)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (≠ S182), G246 (≠ S243), T247 (≠ A244), A248 (≠ S245)
- binding pyridoxal-5'-phosphate: R58 (= R52), K150 (vs. gap), Y155 (≠ L151), E184 (= E179), G187 (≠ S182), L207 (= L204), G209 (= G206), I210 (= I207), T211 (= T208), G246 (≠ S243), T247 (≠ A244)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
29% identity, 96% coverage: 4:277/284 of query aligns to 6:280/297 of 2eiyA
- active site: F35 (≠ Y33), G37 (vs. gap), K150 (vs. gap), E184 (= E179), L207 (= L204)
- binding 4-methyl valeric acid: F35 (≠ Y33), Y94 (≠ L88), T247 (≠ A244), A248 (≠ S245)
- binding pyridoxal-5'-phosphate: R58 (= R52), K150 (vs. gap), Y155 (≠ L151), E184 (= E179), G187 (≠ S182), E188 (≠ N183), L207 (= L204), G209 (= G206), I210 (= I207), T211 (= T208), G246 (≠ S243), T247 (≠ A244)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
29% identity, 96% coverage: 4:277/284 of query aligns to 6:280/297 of 1wrvA
- active site: F35 (≠ Y33), G37 (vs. gap), K150 (vs. gap), E184 (= E179), L207 (= L204)
- binding pyridoxal-5'-phosphate: R58 (= R52), K150 (vs. gap), Y155 (≠ L151), E184 (= E179), G187 (≠ S182), L207 (= L204), G209 (= G206), I210 (= I207), T211 (= T208), T247 (≠ A244)
6fteB Crystal structure of an (r)-selective amine transaminase from exophiala xenobiotica
28% identity, 96% coverage: 4:275/284 of query aligns to 29:305/321 of 6fteB
- active site: Y58 (= Y33), K179 (= K147), E212 (= E179), L234 (= L204)
- binding pyridoxal-5'-phosphate: R77 (= R52), K179 (= K147), E212 (= E179), F216 (≠ N183), N217 (= N184), L234 (= L204), G236 (= G206), V237 (≠ I207), T238 (= T208), T274 (≠ A244)
8ivpB Crystal structure of mv in complex with llp and fru from mycobacterium vanbaalenii
29% identity, 95% coverage: 4:273/284 of query aligns to 30:304/322 of 8ivpB
Query Sequence
>3609767 FitnessBrowser__Dino:3609767
MSRIVYVNGDYLPEEDAKISVFDRGFLFADGVYEVTSVLGGKLIDFEGHAKRLERSLSEL
DMPAPVTMDALLEIHRELVARNEVHEGLVYLQVTRGAADRDFAYPAEPKPSLVLFTQTKT
LADAPVAKTGIKVISIEDQRWGRRDIKTVQLLYPSMGKMMAKAAGVDDAWMVEDGAVTEG
TSNNAYIVTKAGTIVTRHLGNEILHGITRAAVLRFAREAQMAVEERSFTIEEAKDAAEAF
ITSASTFVMPVVELDGAQIGDGTPGPVATRLREIYLEESLKKAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory