Comparing 3609926 FitnessBrowser__Dino:3609926 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3touA Crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound
34% identity, 86% coverage: 10:199/221 of query aligns to 10:197/212 of 3touA
4mk3A Crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h)
32% identity, 89% coverage: 3:199/221 of query aligns to 2:196/203 of 4mk3A
4gltA Crystal structure of glutathione s-transferase mfla_2116 (target efi- 507160) from methylobacillus flagellatus kt with gsh bound
28% identity, 90% coverage: 3:200/221 of query aligns to 8:202/208 of 4gltA
4qq7A Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
28% identity, 90% coverage: 1:199/221 of query aligns to 2:191/204 of 4qq7A
1jlvA Anopheles dirus species b glutathione s-transferases 1-3 (see paper)
28% identity, 86% coverage: 4:194/221 of query aligns to 3:187/207 of 1jlvA
3ublA Crystal structure of glutathione transferase (target efi-501770) from leptospira interrogans with gsh bound
29% identity, 78% coverage: 1:173/221 of query aligns to 2:163/212 of 3ublA
4jedA Crystal structure of glutathione s-transferase mrad2831_1084 (target efi-507060) from methylobacterium radiotolerans jcm 2831, complex with glutathione sulfonate
32% identity, 93% coverage: 3:208/221 of query aligns to 4:202/212 of 4jedA
4i97A The crystal structure of glutathione s-transferase sniggstd1a from scaptomyza nigrita in complex with glutathione
28% identity, 86% coverage: 4:194/221 of query aligns to 3:187/207 of 4i97A
4pnfB Glutathione s-transferase from drosophila melanogaster - isozyme e6 (see paper)
26% identity, 89% coverage: 4:200/221 of query aligns to 5:198/221 of 4pnfB
3wywB Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase (see paper)
26% identity, 95% coverage: 4:212/221 of query aligns to 5:208/214 of 3wywB
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
40% identity, 36% coverage: 15:93/221 of query aligns to 19:102/216 of O43708
Sites not aligning to the query:
8agqA Crystal structure of anthocyanin-related gstf8 from populus trichocarpa in complex with (-)-catechin and glutathione (see paper)
28% identity, 92% coverage: 8:210/221 of query aligns to 7:213/213 of 8agqA
1pn9A Crystal structure of an insect delta-class glutathione s-transferase from a ddt-resistant strain of the malaria vector anopheles gambiae (see paper)
27% identity, 87% coverage: 4:196/221 of query aligns to 3:189/209 of 1pn9A
Sites not aligning to the query:
7dw4A Crystal structure of a glutathione s-transferase mutant sbgstu6(i55t) from salix babylonica in complex with glutathione
25% identity, 89% coverage: 10:205/221 of query aligns to 12:207/220 of 7dw4A
Sites not aligning to the query:
5a5kA Atgstf2 from arabidopsis thaliana in complex with camalexin (see paper)
27% identity, 90% coverage: 3:202/221 of query aligns to 3:209/210 of 5a5kA
1gnwA Structure of glutathione s-transferase (see paper)
27% identity, 90% coverage: 3:202/221 of query aligns to 3:209/210 of 1gnwA
1bx9A Glutathione s-transferase in complex with herbicide (see paper)
27% identity, 90% coverage: 3:202/221 of query aligns to 3:209/210 of 1bx9A
5a4wA Atgstf2 from arabidopsis thaliana in complex with quercetrin (see paper)
27% identity, 90% coverage: 3:202/221 of query aligns to 4:210/211 of 5a4wA
5a4vA Atgstf2 from arabidopsis thaliana in complex with quercetin (see paper)
27% identity, 90% coverage: 3:202/221 of query aligns to 4:210/211 of 5a4vA
5a4uA Atgstf2 from arabidopsis thaliana in complex with indole-3-aldehyde (see paper)
27% identity, 90% coverage: 3:202/221 of query aligns to 4:210/211 of 5a4uA
>3609926 FitnessBrowser__Dino:3609926
MNRLYHVPLSPFCRKVRLVLAEKKIEVELVDEKYWEPSADFLRRNPAGKVPVLKMGGTHL
TESHAIVEYLEELHPTPALLPGTPQDRFEARRLVMWFDDKFHNEVTKNLLYERVNKKIMG
QGYPESRAIKTGAQKIKYHIDYMGWLLEQRRWLAGDAMTIADFTAAAHFSCLDYIRDIDW
NRNAAVKDWYAKIKSRPAFRSILADQIPGFIQPPHYADLDF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory