SitesBLAST
Comparing 3609942 FitnessBrowser__Dino:3609942 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ A35), P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), W322 (≠ L388), E413 (= E481), H414 (= H482), N450 (= N518)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R384), H369 (= H437), H376 (= H444), H414 (= H482)
- binding manganese (ii) ion: H369 (= H437), H376 (= H444), E413 (= E481)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ A35), P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), W323 (≠ L388), E414 (= E481), H415 (= H482), N451 (= N518)
- binding manganese (ii) ion: H370 (= H437), H377 (= H444), E414 (= E481)
- binding pyruvic acid: R319 (= R384), H370 (= H437), H377 (= H444), H415 (= H482)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), W322 (≠ L388), E413 (= E481), H414 (= H482), N450 (= N518)
- binding lactic acid: R318 (= R384), H369 (= H437), H376 (= H444), H414 (= H482)
- binding manganese (ii) ion: H369 (= H437), H376 (= H444), E413 (= E481)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R384), H369 (= H437), H376 (= H444), H414 (= H482)
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), W322 (≠ L388), E413 (= E481), H414 (= H482), N450 (= N518)
- binding manganese (ii) ion: H369 (= H437), H376 (= H444), E413 (= E481)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ S76), R317 (= R384), W321 (≠ L388), H368 (= H437), H375 (= H444), H413 (= H482)
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), W321 (≠ L388), Y322 (≠ N389), E412 (= E481), H413 (= H482), N449 (= N518)
- binding manganese (ii) ion: H368 (= H437), H375 (= H444), E412 (= E481)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R384), W322 (≠ L388), H369 (= H437), H376 (= H444), H413 (= H482)
- binding flavin-adenine dinucleotide: E32 (≠ A35), P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), W322 (≠ L388), E412 (= E481), H413 (= H482), N449 (= N518)
- binding manganese (ii) ion: H369 (= H437), H376 (= H444), E412 (= E481)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R384), W322 (≠ L388), S336 (≠ V404), H369 (= H437), H376 (= H444), H413 (= H482)
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), E412 (= E481), N449 (= N518)
- binding manganese (ii) ion: H369 (= H437), H376 (= H444), E412 (= E481)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R384), W322 (≠ L388), H369 (= H437), H376 (= H444), H414 (= H482)
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), W322 (≠ L388), E413 (= E481), N450 (= N518)
- binding manganese (ii) ion: H369 (= H437), H376 (= H444), E413 (= E481)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), Y324 (≠ N389), H370 (= H437), E414 (= E481), N451 (= N518)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R384), W323 (≠ L388), H415 (= H482)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R384), W323 (≠ L388), H370 (= H437), H415 (= H482)
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), H370 (= H437), E414 (= E481), N451 (= N518)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R384), W323 (≠ L388), H415 (= H482)
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), Y324 (≠ N389), H370 (= H437), E414 (= E481), N451 (= N518)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), H370 (= H437), E414 (= E481), N451 (= N518)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R384), W323 (≠ L388), H415 (= H482)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), H370 (= H437), E414 (= E481), N451 (= N518)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R384), H415 (= H482)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), Y324 (≠ N389), H370 (= H437), E414 (= E481), N451 (= N518)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ S76), R319 (= R384), W323 (≠ L388), H415 (= H482)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
25% identity, 51% coverage: 28:523/973 of query aligns to 25:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (≠ R71), T71 (≠ G72), G72 (= G73), T73 (≠ G74), G74 (≠ T75), G78 (= G79), V79 (≠ Q80), L90 (≠ S91), P132 (≠ T135), G133 (≠ A136), A134 (≠ S137), G140 (= G143), M141 (= M144), A143 (= A146), T144 (≠ N147), A146 (≠ S149), S147 (≠ C150), E200 (= E247), G201 (= G248), I206 (≠ F253), H369 (= H437), E413 (= E481), N450 (= N518)
- binding deaminohydroxyvaline: R319 (= R384), H414 (= H482)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
23% identity, 49% coverage: 50:524/973 of query aligns to 53:465/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P70), G75 (= G72), S76 (≠ G73), G77 (= G74), T78 (= T75), G79 (≠ S76), L80 (≠ Q77), A83 (≠ Q80), C84 (≠ T81), P137 (≠ V133), G138 (≠ S134), E139 (≠ T135), A142 (= A139), T143 (= T140), G146 (= G143), N147 (≠ M144), S149 (≠ A146), T150 (≠ N147), A152 (≠ S149), G153 (≠ C150), E203 (= E247), G204 (= G248), I209 (≠ F253), E422 (= E481), H423 (= H482)
- binding fe (iii) ion: H377 (= H437), H384 (= H444), E422 (= E481)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 49% coverage: 46:523/973 of query aligns to 72:496/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
22% identity, 49% coverage: 48:523/973 of query aligns to 106:517/521 of Q8N465
- S109 (≠ L51) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ L69) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G73) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V87) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ F94) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ I113) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P130) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A146) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A172) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G174) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D373) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R384) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ M391) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ P400) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ S402) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ T422) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G429) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H437) binding ; mutation to A: Loss of catalytic activity.
- G436 (≠ S439) to V: slight reduction in catalytic activity
- N439 (≠ C442) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H444) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N450) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ M451) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ L453) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E481) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H482) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G483) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
22% identity, 49% coverage: 48:523/973 of query aligns to 47:465/465 of 3pm9A
- active site: A149 (≠ S149), L159 (≠ T159)
- binding flavin-adenine dinucleotide: P69 (= P70), Q70 (≠ R71), G71 (= G72), G72 (= G73), N73 (≠ G74), T74 (= T75), G75 (≠ S76), L76 (≠ Q77), G79 (vs. gap), Q80 (= Q80), L91 (≠ S91), L133 (≠ V133), G134 (≠ S134), A135 (≠ T135), C139 (≠ A139), T140 (= T140), G142 (= G142), G143 (= G143), S146 (≠ A146), T147 (≠ N147), A149 (≠ S149), G150 (≠ C150), E200 (= E247), G201 (= G248), I205 (≠ Y252), I206 (≠ F253), E423 (= E481)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
22% identity, 49% coverage: 48:523/973 of query aligns to 54:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (= P70), G78 (= G72), G79 (= G73), N80 (≠ G74), T81 (= T75), G82 (≠ S76), M83 (≠ Q77), G86 (≠ Q80), S87 (≠ T81), L140 (≠ V133), A142 (≠ T135), C146 (≠ A139), H147 (≠ T140), G150 (= G143), N151 (≠ M144), A153 (= A146), T154 (≠ N147), G208 (= G248), I212 (≠ Y252), I213 (≠ F253), E423 (= E481), N460 (= N518)
Sites not aligning to the query:
Query Sequence
>3609942 FitnessBrowser__Dino:3609942
MGMMEKSPLASRLAGKIEGELLFDAFSRGRYATDASIYQMTPLGAVVPKSLDDIETALGA
ARELGASVLPRGGGTSQCGQTVNHSLVLDNSKYFNRILDLDVANRRCVVQPGIVLDELNR
ALKPHGLWFPVDVSTASRATIGGMAANNSCGGRSLRYGTMRDNVLSIEAILADGTRTTFG
PVDRNGVLGNDPTSALISEMLALGAREQAEIAARFPNIIRRVGGYNIDALTPDHARNNMA
HLLVGSEGTLGYFTAIELKLSPLQSTKVTGACHFPTFHAAMDAAQHLVPLKPAAVELVDD
TMIALARDIPMFRQTISQFVQGDPAALLLVEFAEGSDAANAAKLEELSDKMAALGFGFDR
SGKHWGGSVAVTDLKLQNDIGEVRKSGLNIMMSMKSEGKPVSFVEDCAVELPDLAAYTAG
LTEIFEKHGTKGTWYAHASVGCLHVRPVLNMKLDKDVKTMRAIAEECFDLVAHYKGSHSG
EHGDGIVRSEFHEKMFGPQMVASFNEVKDRFDPNRLFNPGKIVQPPKMDDRRLFRYGPDY
TVKPMKTALDWSAWPGAGGGFQGAVEMCNNNGACRKLKGGVMCPSYRVTRNERDVVRGRA
NSLRLAISGQLGPDAFASDDMVSAMKLCVSCKGCKRECPTGVDMAKMKIEVLAARAEKHG
LSFHDKLVGYMPAYAPFAAKLPWLANARNWLPGAAKLTERLTGFAASRKLPAWSNDPFLD
TEFQDADPDVVLWADIFNRYFEPENLRAAGRVLRAAGLRVAVVRPADGKDPLDCGRTYLA
VGLVEEARASARRALKALVPHAEKGVPIVGLEPSSLLTLRDEWPVLVPGPEADLVAQHAL
MLEEYLVRNEIALPLKPLGRPILLHGHCHQKAHNVMPDVQKTLAMIPQAEVSVVETSCCG
MAGAFGYGKDTVETSLKMAELDLLPAVRAAAQDALVVADGTSCRHQIKDGAAREAIHVAR
ILEMALDAGGKGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory