SitesBLAST
Comparing 3609943 FitnessBrowser__Dino:3609943 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q56YA5 Serine--glyoxylate aminotransferase; Alanine--glyoxylate aminotransferase; AGT; Asparagine aminotransferase; Serine--pyruvate aminotransferase; EC 2.6.1.45; EC 2.6.1.44; EC 2.6.1.-; EC 2.6.1.51 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
45% identity, 92% coverage: 26:414/422 of query aligns to 2:393/401 of Q56YA5
- TGT 68:70 (≠ SGT 91:93) binding
- T148 (= T171) binding
- QK 200:201 (= QK 223:224) binding
- K201 (= K224) binding
- P251 (= P273) mutation to L: Abolishes aminotransferase activity.
- R347 (= R369) binding
6pk3B Alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana (see paper)
45% identity, 92% coverage: 26:414/422 of query aligns to 1:392/400 of 6pk3B
6pk1A Alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana in presence of serine (see paper)
45% identity, 92% coverage: 28:414/422 of query aligns to 2:391/399 of 6pk1A
2dr1A Crystal structure of the ph1308 protein from pyrococcus horikoshii ot3
32% identity, 83% coverage: 33:382/422 of query aligns to 16:364/381 of 2dr1A
3islA Crystal structure of ureidoglycine-glyoxylate aminotransferase (pucg) from bacillus subtilis
30% identity, 89% coverage: 36:409/422 of query aligns to 10:383/387 of 3islA
O32148 (S)-ureidoglycine--glyoxylate transaminase; UGXT; (S)-ureidoglycine--glyoxylate aminotransferase; Purine catabolism protein PucG; EC 2.6.1.112 from Bacillus subtilis (strain 168) (see paper)
30% identity, 93% coverage: 19:409/422 of query aligns to 3:405/416 of O32148
- Q37 (≠ H59) mutation to H: 5-fold decrease in transamination activity.
- K198 (= K224) modified: N6-(pyridoxal phosphate)lysine
- N264 (vs. gap) mutation to S: 9-fold decrease in transamination activity.; mutation to Y: Loss of transamination activity.
1vjoA Crystal structure of alanine--glyoxylate aminotransferase (alr1004) from nostoc sp. At 1.70 a resolution (see paper)
31% identity, 85% coverage: 21:378/422 of query aligns to 7:360/377 of 1vjoA
1h0cA The crystal structure of human alanine:glyoxylate aminotransferase (see paper)
31% identity, 80% coverage: 39:374/422 of query aligns to 25:360/385 of 1h0cA
- binding (aminooxy)acetic acid: P25 (= P39), G26 (= G40), L346 (= L360), R355 (= R369)
- binding pyridoxal-5'-phosphate: S78 (= S91), G79 (= G92), H80 (≠ T93), W105 (≠ F118), S153 (≠ T171), D178 (= D198), V180 (≠ I200), K204 (= K224)
Sites not aligning to the query:
1j04A Structural mechanism of enzyme mistargeting in hereditary kidney stone disease in vitro (see paper)
31% identity, 80% coverage: 39:374/422 of query aligns to 25:362/387 of 1j04A
6rv0A Human alanine:glyoxylate aminotransferase major allele (agt-ma); with pmp in the active site (see paper)
30% identity, 80% coverage: 39:374/422 of query aligns to 23:360/384 of 6rv0A
5hhyA Structure of human alanine:glyoxylate aminotransferase major allele (agt-ma) showing x-ray induced reduction of plp internal aldimine to 4'-deoxy-piridoxine-phosphate (plr) (see paper)
30% identity, 80% coverage: 39:374/422 of query aligns to 23:360/385 of 5hhyA
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: S76 (= S91), G77 (= G92), H78 (≠ T93), W103 (≠ F118), S153 (≠ T171), D178 (= D198), V180 (≠ I200), Q203 (= Q223), K204 (= K224), Y255 (≠ F269), T258 (= T272)
P21549 Alanine--glyoxylate aminotransferase; AGT; Serine--pyruvate aminotransferase; SPT; EC 2.6.1.44; EC 2.6.1.51 from Homo sapiens (Human) (see 24 papers)
30% identity, 80% coverage: 39:374/422 of query aligns to 28:365/392 of P21549
- R36 (= R47) to C: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177157
- G41 (≠ I52) to E: in HP1; loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177168; to R: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of protein stability; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; partial mitochondrial mistargeting; intraperoxisomal protein aggregation seen; dbSNP:rs121908523; to V: in HP1; reduced alanine--glyoxylate aminotransferase activity; no loss of dimerization; no effect on protein stability; dbSNP:rs180177168
- G47 (≠ D58) to R: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in protein misfolding; decreased alanine--glyoxylate aminotransferase activity; reduced expression levels; reduced pyridoxal phosphate binding; reduced dimerization; reduced thermostability; increased propensity to aggregation; increased susceptibility to proteolytic degradation within the N-terminal region; mitochondrial mistargeting; exposure to pyridoxine can rescue the functionality by partially preventing aggregation and degradation and by redirecting all the protein to the peroxisome; dbSNP:rs180177173
- G82 (= G92) to E: in HP1; abolishes alanine--glyoxylate aminotransferase activity by interfering with pyridoxal phosphate binding; dbSNP:rs121908522
- W108 (≠ F118) to R: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; dbSNP:rs180177197
- A112 (≠ W122) to D: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; causes protein aggregation; dbSNP:rs796052061
- L150 (≠ A163) to P: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177222
- F152 (≠ C165) to I: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in protein destabilization; decreased alanine--glyoxylate aminotransferase activity; no loss of dimerization; mitochondrial mistargeting; dbSNP:rs121908524
- G156 (≠ N169) to R: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; dbSNP:rs121908530
- S158 (≠ T171) to L: in HP1; loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177225
- G161 (= G174) to C: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; reduced expression levels; decreased protein stability; protein aggregation seen in the cytosol with a decreased aggregation propensity in the presence of pyridoxal phosphate; reduced peroxisomal localization; dbSNP:rs180177227; to R: in HP1; loss of alanine--glyoxylate aminotransferase activity; reduced expression levels; decreased protein stability; protein aggregation seen in the cytosol with a decreased aggregation propensity in the presence of pyridoxal phosphate; loss of dimerization; dbSNP:rs180177227; to S: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; reduced expression levels; decreased protein stability; protein aggregation seen in the cytosol with a decreased aggregation propensity in the presence of pyridoxal phosphate; reduced peroxisomal localization; dbSNP:rs180177227
- L166 (≠ M186) to P: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177230
- G170 (= G190) to R: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in mitochondrial mistargeting; slight decrease in alanine--glyoxylate aminotransferase activity; loss of dimerization; partial loss of protein stability but protein stability increases in the presence of pyridoxal phosphate; causes protein aggregation; dbSNP:rs121908529
- C173 (vs. gap) to Y: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; causes protein aggregation; dbSNP:rs180177231
- D183 (= D198) to N: in HP1; loss of alanine--glyoxylate aminotransferase activity; no loss of dimerization; no effect on protein stability; dbSNP:rs180177236
- S187 (≠ G202) to F: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization but improved dimerization in the presence of pyridoxal phosphate; decreased protein stability; dbSNP:rs180177238
- I202 (≠ V217) to N: in HP1; uncertain significance; dbSNP:rs536352238
- S205 (= S220) to P: in HP1; loss of alanine--glyoxylate aminotransferase activity; decreased protein stability; dbSNP:rs121908520
- K209 (= K224) mutation to R: Affects pyridoxal phosphate binding; loss of alanine--glyoxylate aminotransferase activity.
- S218 (= S233) to L: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; no effect on protein stability; dbSNP:rs180177253
- R233 (≠ A248) to C: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs121908526; to H: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs121908527
- I244 (vs. gap) to T: in HP1; prevalent mutation in the Canary islands; when associated with L-11 and M-340 on the minor AGXT allele; results in protein misfolding; decreased alanine--glyoxylate aminotransferase activity; no loss of dimerization; partial mitochondrial mistargeting; dbSNP:rs121908525
- C253 (≠ G262) to R: in HP1; when associated with L-11 and M-340 on the minor AGXT allele; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177264
- I279 (≠ L288) to T: in dbSNP:rs140992177
- A280 (≠ H289) to V: in dbSNP:rs73106685
- V326 (≠ M335) to I: in dbSNP:rs115057148
- I340 (≠ L349) to M: associated with hyperoxaluria; dbSNP:rs4426527
Sites not aligning to the query:
- 9 T → N: no loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs115014558
- 11 P → L: reduction of specific alanine--glyoxylate aminotransferase activity in vitro; causes mitochondrial mistargeting when associated with R-170; dbSNP:rs34116584
2huuA Crystal structure of aedes aegypti alanine glyoxylate aminotransferase in complex with alanine (see paper)
29% identity, 86% coverage: 10:374/422 of query aligns to 2:361/385 of 2huuA
2huiA Crystal structure of aedes aegypti alanine glyoxylate aminotransferase in complex with glyoxylic acid (see paper)
29% identity, 86% coverage: 10:374/422 of query aligns to 2:361/385 of 2huiA
2hufA Crystal structure of aedes aegypti alanine glyoxylate aminotransferase (see paper)
29% identity, 86% coverage: 10:374/422 of query aligns to 2:361/385 of 2hufA
Q3LSM4 Alanine--glyoxylate aminotransferase; EC 2.6.1.44 from Aedes aegypti (Yellowfever mosquito) (Culex aegypti) (see paper)
30% identity, 81% coverage: 35:374/422 of query aligns to 21:361/393 of Q3LSM4
- SGH 78:80 (≠ SGT 91:93) binding in other chain
- S155 (≠ T171) binding ; binding
- Q205 (= Q223) binding in other chain
- K206 (= K224) modified: N6-(pyridoxal phosphate)lysine
- Y257 (≠ F269) binding
- T260 (= T272) binding
- R356 (= R369) binding
2z9xA Crystal structure of pyridoxamine-pyruvate aminotransferase complexed with pyridoxyl-l-alanine (see paper)
29% identity, 92% coverage: 20:408/422 of query aligns to 2:385/392 of 2z9xA
2z9wA Crystal structure of pyridoxamine-pyruvate aminotransferase complexed with pyridoxal (see paper)
29% identity, 92% coverage: 20:408/422 of query aligns to 2:385/392 of 2z9wA
2z9vA Crystal structure of pyridoxamine-pyruvate aminotransferase complexed with pyridoxamine (see paper)
29% identity, 92% coverage: 20:408/422 of query aligns to 2:385/392 of 2z9vA
Q988B8 Pyridoxamine--pyruvate transaminase; Pyridoxamine-pyruvate aminotransferase; EC 2.6.1.30 from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) (Mesorhizobium loti (strain MAFF 303099)) (see 2 papers)
29% identity, 92% coverage: 20:408/422 of query aligns to 3:386/393 of Q988B8
- E68 (≠ S91) binding ; mutation E->A,G: Low but detectable pyridoxamine--pyruvate transaminase activity.
- Y95 (≠ F118) binding
- T146 (= T171) binding
- K197 (= K224) modified: N6-(pyridoxal phosphate)lysine; mutation to L: Loss of function.
- C198 (≠ G225) mutation to A: No effect on enzyme activity.
- R336 (≠ L360) mutation to A: Strongly decreased affinity for pyruvate.
- R345 (= R369) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>3609943 FitnessBrowser__Dino:3609943
MNSLLCMHNEKRLPCPSRGRQPEETDPMRKAGRHFLQIPGPSAVPDRILRAISMQTIDHR
GPDFADVGQKALKGMKTIFRTDQNVFIFPSSGTGAWEAALVNTMSPGDTVLMYETGHFAT
LWQKMAKKIGLNPVFIEGDWRGGADPQAIEDALRKDTDHEIKAVCVVHNETSTGSVSPIA
EVRAAMDATGHPALLMVDSISGLASVPFEFDAWGVDVCVSGSQKGLMLPPGLSFNAVSDK
ALEVAKSAKMQRSYWDWLDMVGPNATGYFPYTPGTNLLYGLNEAVDMLHEEGLENVFERH
RRHGAATRAAVRAWGLEVLCARQGQESGVLTAVMMPEGHSADAFRATTLAHYDISLGNGL
SKVADKVFRIGHLGDFNDLMLMATLSGVEMGLAKAGVPHESGGVQAAMDHLKTHEAVKVA
AE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory