SitesBLAST
Comparing 3609962 FitnessBrowser__Dino:3609962 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
44% identity, 100% coverage: 3:413/413 of query aligns to 1:423/423 of 5g4jA
- active site: S14 (≠ V16), Y130 (= Y132), D201 (≠ C195), D234 (= D228), Q237 (= Q231), K264 (= K258), T294 (= T288), K395 (= K385)
- binding {5-hydroxy-6-methyl-4-[(E)-{[2-(phosphonooxy)ethyl]imino}methyl]pyridin-3-yl}methyl dihydrogen phosphate: Y44 (= Y46), R73 (= R75), G103 (= G105), S104 (= S106), Y130 (= Y132), H131 (= H133), D234 (= D228), V236 (= V230), Q237 (= Q231), K264 (= K258), T294 (= T288), R397 (= R387)
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
44% identity, 100% coverage: 3:413/413 of query aligns to 1:423/423 of 5g4iA
- active site: S14 (≠ V16), Y130 (= Y132), D201 (≠ C195), D234 (= D228), Q237 (= Q231), K264 (= K258), T294 (= T288), K395 (= K385)
- binding pyridoxal-5'-phosphate: G103 (= G105), S104 (= S106), H131 (= H133), D234 (= D228), V236 (= V230), Q237 (= Q231), K264 (= K258)
- binding phosphate ion: Y44 (= Y46), R397 (= R387)
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
38% identity, 92% coverage: 24:404/413 of query aligns to 1:390/404 of 6torB
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
32% identity, 99% coverage: 2:409/413 of query aligns to 4:421/425 of 1szkA
- active site: V18 (= V16), Y137 (= Y132), E205 (≠ C195), D238 (= D228), Q241 (= Q231), K267 (= K258), T296 (= T288), R397 (≠ K385)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G110 (= G105), S111 (= S106), Y137 (= Y132), H138 (= H133), E205 (≠ C195), D238 (= D228), V240 (= V230), Q241 (= Q231), K267 (= K258)
P22256 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 99% coverage: 2:409/413 of query aligns to 5:422/426 of P22256
- I50 (≠ V49) mutation to Q: 3-fold decrease in catalytic activity and 12-fold decrease in affinity for GABA.
- GS 111:112 (= GS 105:106) binding
- E211 (≠ N200) mutation to S: 100-fold decrease in catalytic activity and 15-fold decrease in affinity for GABA.
- V241 (= V230) mutation to A: 25-fold decrease in catalytic activity and 5-fold decrease in affinity for GABA.
- Q242 (= Q231) binding
- K268 (= K258) modified: N6-(pyridoxal phosphate)lysine
- T297 (= T288) binding
1sffA Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate (see paper)
32% identity, 99% coverage: 2:409/413 of query aligns to 4:421/425 of 1sffA
- active site: V18 (= V16), Y137 (= Y132), E205 (≠ C195), D238 (= D228), Q241 (= Q231), K267 (= K258), T296 (= T288), R397 (≠ K385)
- binding 4'-deoxy-4'-acetylyamino-pyridoxal-5'-phosphate: Q78 (≠ L77), G110 (= G105), S111 (= S106), Y137 (= Y132), H138 (= H133), R140 (≠ N135), E205 (≠ C195), D238 (= D228), V240 (= V230), Q241 (= Q231), K267 (= K258), T296 (= T288)
- binding sulfate ion: N152 (≠ P147), Y393 (≠ M381)
1sf2A Structure of e. Coli gamma-aminobutyrate aminotransferase (see paper)
32% identity, 99% coverage: 2:409/413 of query aligns to 4:421/425 of 1sf2A
- active site: V18 (= V16), Y137 (= Y132), E205 (≠ C195), D238 (= D228), Q241 (= Q231), K267 (= K258), T296 (= T288), R397 (≠ K385)
- binding pyridoxal-5'-phosphate: G110 (= G105), S111 (= S106), Y137 (= Y132), H138 (= H133), E205 (≠ C195), D238 (= D228), V240 (= V230), Q241 (= Q231), K267 (= K258)
- binding sulfate ion: N152 (≠ P147), Y393 (≠ M381)
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
32% identity, 93% coverage: 24:408/413 of query aligns to 29:394/395 of Q5SHH5
- GT 113:114 (≠ GS 105:106) binding
- K254 (= K258) modified: N6-(pyridoxal phosphate)lysine
- T283 (= T288) binding
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
32% identity, 93% coverage: 24:408/413 of query aligns to 21:386/387 of 1wkhA
- active site: F132 (≠ Y132), E184 (≠ C195), D217 (= D228), Q220 (= Q231), K246 (= K258), T275 (= T288), R363 (≠ K385)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: Y46 (vs. gap), S104 (≠ T104), G105 (= G105), T106 (≠ S106), F132 (≠ Y132), S133 (≠ H133), E184 (≠ C195), E189 (≠ N200), D217 (= D228), I219 (≠ V230), K246 (= K258), R363 (≠ K385)
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
32% identity, 93% coverage: 24:408/413 of query aligns to 21:386/387 of 1wkgA
- active site: F132 (≠ Y132), E184 (≠ C195), D217 (= D228), Q220 (= Q231), K246 (= K258), T275 (= T288), R363 (≠ K385)
- binding n~2~-acetyl-n~5~-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-l-ornithine: Y46 (vs. gap), G105 (= G105), T106 (≠ S106), F132 (≠ Y132), S133 (≠ H133), R135 (≠ N135), E184 (≠ C195), D217 (= D228), I219 (≠ V230), Q220 (= Q231), K246 (= K258), G273 (≠ F286), T274 (≠ N287), T275 (= T288)
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
32% identity, 93% coverage: 24:408/413 of query aligns to 21:386/387 of 1vefA
- active site: F132 (≠ Y132), D217 (= D228), K246 (= K258), T275 (= T288), R363 (≠ K385)
- binding pyridoxal-5'-phosphate: G105 (= G105), T106 (≠ S106), F132 (≠ Y132), S133 (≠ H133), E184 (≠ C195), D217 (= D228), I219 (≠ V230), K246 (= K258)
Sites not aligning to the query:
6s54A Transaminase from pseudomonas fluorescens (see paper)
31% identity, 94% coverage: 23:412/413 of query aligns to 31:452/453 of 6s54A
- active site: Y152 (= Y132), D258 (= D228), K287 (= K258)
- binding pyridoxal-5'-phosphate: G119 (= G105), S120 (= S106), Y152 (= Y132), H153 (= H133), G154 (= G134), E225 (≠ C195), D258 (= D228), V260 (= V230), I261 (≠ Q231), K287 (= K258)
Sites not aligning to the query:
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
34% identity, 90% coverage: 19:390/413 of query aligns to 15:365/390 of A0QYS9
- K304 (≠ R320) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
1zobA Crystal structure of dialkylglycine decarboxylases bound with calcium ion
32% identity, 91% coverage: 23:398/413 of query aligns to 24:417/431 of 1zobA
- active site: W136 (≠ Y132), E208 (≠ C195), D241 (= D228), Q244 (= Q231), K270 (= K258), T301 (= T288), R404 (≠ K385)
- binding calcium ion: L76 (≠ T72), S78 (≠ T74), V303 (≠ G290), S304 (≠ G291), D305 (≠ S292)
- binding pyridoxal-5'-phosphate: T108 (= T104), A110 (≠ S106), N113 (≠ V109), W136 (≠ Y132), H137 (= H133), E208 (≠ C195), D241 (= D228), A243 (≠ V230), Q244 (= Q231), K270 (= K258)
Sites not aligning to the query:
1zc9A The crystal structure of dialkylglycine decarboxylase complex with pyridoxamine 5-phosphate (see paper)
32% identity, 91% coverage: 23:398/413 of query aligns to 24:417/431 of 1zc9A
- active site: W136 (≠ Y132), E208 (≠ C195), D241 (= D228), Q244 (= Q231), K270 (= K258), T301 (= T288), R404 (≠ K385)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G109 (= G105), A110 (≠ S106), W136 (≠ Y132), H137 (= H133), E208 (≠ C195), D241 (= D228), A243 (≠ V230), Q244 (= Q231), K270 (= K258)
Sites not aligning to the query:
1m0qA Structure of dialkylglycine decarboxylase complexed with s-1- aminoethanephosphonate (see paper)
32% identity, 91% coverage: 23:398/413 of query aligns to 24:417/431 of 1m0qA
- active site: W136 (≠ Y132), E208 (≠ C195), D241 (= D228), Q244 (= Q231), K270 (= K258), T301 (= T288), R404 (≠ K385)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: Q50 (≠ V49), T108 (= T104), A110 (≠ S106), W136 (≠ Y132), H137 (= H133), E208 (≠ C195), S213 (≠ N200), D241 (= D228), A243 (≠ V230), Q244 (= Q231), K270 (= K258), R404 (≠ K385)
Sites not aligning to the query:
1m0pA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- phenylethanephosphonate (see paper)
32% identity, 91% coverage: 23:398/413 of query aligns to 24:417/431 of 1m0pA
- active site: W136 (≠ Y132), E208 (≠ C195), D241 (= D228), Q244 (= Q231), K270 (= K258), T301 (= T288), R404 (≠ K385)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-phenylethylphosphonic acid: Q50 (≠ V49), T108 (= T104), A110 (≠ S106), W136 (≠ Y132), H137 (= H133), E208 (≠ C195), S213 (≠ N200), D241 (= D228), A243 (≠ V230), Q244 (= Q231), K270 (= K258), R404 (≠ K385)
Sites not aligning to the query:
1m0oA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- methylpropanephosphonate (see paper)
32% identity, 91% coverage: 23:398/413 of query aligns to 24:417/431 of 1m0oA
- active site: W136 (≠ Y132), E208 (≠ C195), D241 (= D228), Q244 (= Q231), K270 (= K258), T301 (= T288), R404 (≠ K385)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-methylpropylphosphonic acid: Q50 (≠ V49), G109 (= G105), A110 (≠ S106), W136 (≠ Y132), H137 (= H133), E208 (≠ C195), D241 (= D228), Q244 (= Q231), K270 (= K258), R404 (≠ K385)
Sites not aligning to the query:
1m0nA Structure of dialkylglycine decarboxylase complexed with 1- aminocyclopentanephosphonate (see paper)
32% identity, 91% coverage: 23:398/413 of query aligns to 24:417/431 of 1m0nA
- active site: W136 (≠ Y132), E208 (≠ C195), D241 (= D228), Q244 (= Q231), K270 (= K258), T301 (= T288), R404 (≠ K385)
- binding 1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]cyclopentylphosphonic acid: Q50 (≠ V49), M51 (≠ P50), A110 (≠ S106), N113 (≠ V109), W136 (≠ Y132), H137 (= H133), E208 (≠ C195), S213 (≠ N200), D241 (= D228), A243 (≠ V230), Q244 (= Q231), K270 (= K258), R404 (≠ K385)
Sites not aligning to the query:
1dgdA An alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase (see paper)
32% identity, 91% coverage: 23:398/413 of query aligns to 24:417/431 of 1dgdA
- active site: W136 (≠ Y132), E208 (≠ C195), D241 (= D228), Q244 (= Q231), K270 (= K258), T301 (= T288), R404 (≠ K385)
- binding pyridoxal-5'-phosphate: T108 (= T104), G109 (= G105), A110 (≠ S106), W136 (≠ Y132), H137 (= H133), E208 (≠ C195), D241 (= D228), A243 (≠ V230), Q244 (= Q231), K270 (= K258)
Sites not aligning to the query:
Query Sequence
>3609962 FitnessBrowser__Dino:3609962
MSDLLKRRARLMGPNVPTFYDPPLHIVRGEGVWLWDAGGRRYLDCYNNVPHVGHCHPRVV
DAIARQARVLNTHTRYLHEGVLDYIERLTGTMDNGLDQALLVCTGSEAVDVALRMARAAT
GKTGLIATDNTYHGNTTAVAQLSTRRPPIGGYSDHVRLVPAPEPGTDGAAFGAHVARAAA
ELETAGHGVAALIVCPIFANEGLPCLPRGFLEPAVAALRTRGGLLISDEVQPGFGRLGDV
FWGYQALGIAPDVVTLGKSMGNGYPVAGVVARTEIMGAFREAFGYFNTFGGSPVAAAAAM
AVLDVLEDEGLVENAKRVGRYTLERLQALRHPAIDGVRGYGLAFALDLVDTDGAPNTALA
AAVTEEAKRRSVLINRIGRDMHILKIRPPLPFAPEHGDRLGDVLQAAFDACPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory