SitesBLAST
Comparing 3610039 FitnessBrowser__Dino:3610039 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
66% identity, 94% coverage: 26:513/519 of query aligns to 4:490/497 of O86033
- R82 (= R104) binding
- E83 (= E105) binding
- Y134 (= Y156) binding
- D243 (= D265) binding
- Q244 (= Q266) binding
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
52% identity, 94% coverage: 26:515/519 of query aligns to 4:491/496 of P18157
- H230 (= H252) mutation to R: Increased activity.
- F232 (≠ L253) mutation to S: Increased activity.
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
53% identity, 95% coverage: 25:517/519 of query aligns to 4:494/499 of 3ge1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
53% identity, 95% coverage: 25:517/519 of query aligns to 3:493/498 of Q5HGD2
- T12 (= T34) binding
- R16 (= R38) binding
- R82 (= R104) binding
- E83 (= E105) binding
- Y134 (= Y156) binding
- D244 (= D265) binding
- Q245 (= Q266) binding
- T266 (= T287) binding
- G309 (= G330) binding
- Q313 (= Q334) binding
- G410 (= G434) binding
- N414 (≠ S438) binding
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
52% identity, 95% coverage: 25:518/519 of query aligns to 5:495/501 of O34154
- H231 (= H252) modified: Phosphohistidine; by HPr
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
52% identity, 95% coverage: 25:517/519 of query aligns to 5:495/506 of O34153
- R84 (= R104) binding
- E85 (= E105) binding
- Y136 (= Y156) binding
- H232 (= H252) modified: Phosphohistidine; by HPr; mutation to A: Loss of phosphorylation, no effect on activity.; mutation to E: Loss of phosphorylation, 2.5-fold reduced activity.; mutation to R: Loss of phosphorylation, 3.4-fold increased activity.
- D246 (= D265) binding
- Q247 (= Q266) binding
3h3nX Glycerol kinase h232r with glycerol (see paper)
52% identity, 95% coverage: 25:517/519 of query aligns to 4:494/501 of 3h3nX
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
52% identity, 94% coverage: 25:513/519 of query aligns to 3:489/498 of 1glfO
- binding adenosine-5'-diphosphate: R16 (= R38), G265 (= G286), T266 (= T287), G309 (= G330), G410 (= G434), A411 (≠ M435)
- binding glycerol: R82 (= R104), E83 (= E105), Y134 (= Y156), D244 (= D265)
- binding phosphate ion: G232 (= G254), G233 (= G255), R235 (vs. gap)
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
52% identity, 94% coverage: 25:513/519 of query aligns to 3:489/498 of 1bo5O
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
52% identity, 94% coverage: 25:513/519 of query aligns to 3:489/499 of 1bu6Y
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
52% identity, 94% coverage: 25:513/519 of query aligns to 5:491/502 of P0A6F3
- T14 (= T34) binding ; binding
- R18 (= R38) binding
- S59 (≠ R79) mutation to W: Abolishes inhibition of GK by FBP via disruption of the dimer-tetramer assembly reaction. Inhibition by EIIA-Glc is unchanged compared to wild type. The activity of this mutant is significantly higher than wild-type, and the Michaelis constants are increased slightly compared to wild-type.
- A66 (≠ E86) mutation to T: Although it completely abolishes FBP regulation and disrupts dimer-tetramer equilibrium, the crystal structure is essentially identical to the symmetric tetramer found in the FBP-bound form of the enzyme.
- R84 (= R104) binding ; binding
- E85 (= E105) binding ; binding
- Y136 (= Y156) binding ; binding
- G231 (≠ E251) mutation to D: Displays an increased enzymatic activity and a decreased allosteric regulation by FBP compared to wild-type. It displays a dimer form and is resistant to tetramer formation in the presence of FBP, whereas wild-type dimers are converted into inactive tetramers in the presence of FBP.
- K233 (≠ L253) modified: N6-malonyllysine
- G235 (= G255) binding
- R237 (vs. gap) binding ; mutation to A: Drastically reduces inhibition of GK by FBP and lowers, but did not eliminate, the ability of FBP to promote tetramer association.
- D246 (= D265) binding ; binding
- Q247 (= Q266) binding
- T268 (= T287) binding
- G305 (= G324) mutation to S: In glpK22; abolishes glucose control of glycerol utilization.
- G311 (= G330) binding
- G412 (= G434) binding
- N416 (≠ S438) binding
- I475 (≠ M497) mutation to D: It decreases Vmax to about 10% of the wild-type value and the affinity for substrate is increased about two- to fourfold. This mutation decreases the catalytic activity in a manner that is analogous to that obtained upon EIIA-Glc binding. It increases the affinity for FBP about fivefold.
- E479 (≠ T501) binding
- R480 (= R502) mutation to D: It decreases Vmax to about 10% of the wild-type value and the affinity for substrate is increased about two- to fourfold. This mutation decreases the catalytic activity in a manner that is analogous to that obtained upon EIIA-Glc binding. Regulation by FBP is not affected by this substitution. No inhibition by EIIA-Glc is observed, which is consistent with a decrease in affinity for EIIA-Glc of about 250-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
52% identity, 94% coverage: 25:513/519 of query aligns to 3:485/494 of 1gllO
- binding phosphomethylphosphonic acid adenylate ester: T12 (= T34), T13 (= T35), G261 (= G286), T262 (= T287), G305 (= G330), I308 (≠ V333), Q309 (= Q334), A321 (= A346), G406 (= G434), N410 (≠ S438)
- binding glycerol: R82 (= R104), E83 (= E105), Y134 (= Y156), D240 (= D265), Q241 (= Q266), F265 (= F290)
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
52% identity, 94% coverage: 25:513/519 of query aligns to 3:485/494 of 1gljO
- binding gamma-arsono-beta, gamma-methyleneadenosine-5'-diphosphate: T12 (= T34), T13 (= T35), G261 (= G286), T262 (= T287), G305 (= G330), Q309 (= Q334), A321 (= A346), G406 (= G434), A407 (≠ M435)
- binding glycerol: R82 (= R104), E83 (= E105), W102 (= W124), Y134 (= Y156), D240 (= D265), F265 (= F290)
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
52% identity, 94% coverage: 25:513/519 of query aligns to 3:485/494 of 1bwfO
- binding phosphodifluoromethylphosphonic acid-adenylate ester: T12 (= T34), T13 (= T35), T262 (= T287), G305 (= G330), I308 (≠ V333), Q309 (= Q334), A321 (= A346), G406 (= G434), N410 (≠ S438)
- binding glycerol: R82 (= R104), E83 (= E105), W102 (= W124), Y134 (= Y156), D240 (= D265), Q241 (= Q266), F265 (= F290)
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
52% identity, 94% coverage: 25:513/519 of query aligns to 1:480/489 of 1gldG
- binding adenosine-5'-diphosphate: R14 (= R38), G256 (= G286), T257 (= T287), G300 (= G330), A316 (= A346), G401 (= G434), A402 (≠ M435), N405 (≠ S438)
- binding glyceraldehyde-3-phosphate: T10 (= T34), R80 (= R104), E81 (= E105), Y132 (= Y156), D235 (= D265), F260 (= F290)
- binding manganese (ii) ion: D7 (= D31), R14 (= R38)
1glcG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
52% identity, 94% coverage: 25:513/519 of query aligns to 1:480/489 of 1glcG
- binding adenosine-5'-diphosphate: G256 (= G286), T257 (= T287), G300 (= G330), A316 (= A346), G401 (= G434), A402 (≠ M435), N405 (≠ S438)
- binding glyceraldehyde-3-phosphate: T10 (= T34), R80 (= R104), E81 (= E105), W100 (= W124), Y132 (= Y156), D235 (= D265), F260 (= F290)
1glbG Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase (see paper)
52% identity, 94% coverage: 25:513/519 of query aligns to 1:480/489 of 1glbG
- binding adenosine-5'-diphosphate: R14 (= R38), G256 (= G286), T257 (= T287), G300 (= G330), I303 (≠ V333), A316 (= A346), G401 (= G434), A402 (≠ M435), N405 (≠ S438)
- binding glycerol: R80 (= R104), E81 (= E105), W100 (= W124), Y132 (= Y156), D235 (= D265), F260 (= F290)
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
48% identity, 95% coverage: 25:517/519 of query aligns to 3:490/495 of 6udeB
- binding adenosine-5'-diphosphate: R16 (= R38), G262 (= G286), T263 (= T287), G306 (= G330), I309 (≠ V333), S323 (= S347), G406 (= G433), G407 (= G434), A408 (≠ M435)
- binding magnesium ion: G11 (= G33), T12 (= T34), T13 (= T35), S14 (= S36)
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
52% identity, 94% coverage: 27:513/519 of query aligns to 1:474/485 of 6k76A
6zq4F Crystal structure of chaetomium thermophilum glycerol kinase in complex with substrate in p1 space group (see paper)
43% identity, 94% coverage: 27:513/519 of query aligns to 4:503/512 of 6zq4F
Query Sequence
>3610039 FitnessBrowser__Dino:3610039
MDRQRGQFLLNLRALKPRPGEGTVRHVLAIDQGTTSSRAIVFDADMNIVSIAQEEFAQHY
PDSGWVEHDPEDLWDTVLRTCRNVLERTGLAATDLAGIGITNQRETTVVWDKSTGKPIHN
AIVWQDRRTAPFCAELRKAGHDALITAQTGLLADPYFSGTKLKYILDTVEGARDRAKAGE
LLFGTVDSFLIWRLTNGAAHVTDATNAARTMLYDIHKGAWSAEICTLFDIPLGMLPQVHD
CDAEFGTCTPEHLGGAVPILGVAGDQQAATIGQACFEPGMLKSTYGTGCFALLNTGEAPV
TSTNRLLTTIAYQLDGKPTYALEGSIFVAGAVVQWLRDGLKLIANASETQPLAEAADPHD
PVILVPAFTGLGAPYWNAECRGAVFGLSRGSGPEEFARAALESVGYQTRDLLEAMHKDWS
DAREGQPTLRVDGGMTASDWTMQFLADIIDAPVDRPKITETTALGVAWLAGQKAGLYPDR
AGFAANWALDQRFEPKMDATTRDTKYAAWKRAVAAVQQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory