SitesBLAST
Comparing 3610092 Dshi_3473 threonine dehydratase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
33% identity, 95% coverage: 17:407/413 of query aligns to 20:410/494 of 1tdjA
- active site: K58 (= K52), A83 (= A76), E209 (= E206), S213 (≠ A210), C215 (≠ S212), G237 (= G234), L310 (≠ T306), S311 (= S307)
- binding pyridoxal-5'-phosphate: F57 (≠ Y51), K58 (= K52), N85 (= N78), G184 (= G181), G185 (= G182), G186 (= G183), G187 (= G184), G237 (= G234), E282 (= E280), S311 (= S307), G312 (= G308)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
33% identity, 95% coverage: 17:407/413 of query aligns to 24:414/514 of P04968
- K62 (= K52) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N78) binding
- GGGGL 188:192 (= GGGGL 181:185) binding
- S315 (= S307) binding
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
34% identity, 70% coverage: 29:319/413 of query aligns to 33:321/326 of 2gn2A
- active site: K56 (= K52), A81 (= A76), Q207 (≠ E206), V211 (≠ A210), G213 (≠ S212), G235 (= G234), I308 (≠ T306), S309 (= S307)
- binding cytidine-5'-monophosphate: R51 (≠ P47), T52 (≠ V48), G53 (≠ R49), A114 (≠ K109), D117 (≠ I112), Y118 (≠ F113), N312 (= N310)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
30% identity, 74% coverage: 10:315/413 of query aligns to 11:312/319 of A4F2N8
- K53 (= K52) mutation to A: Loss of enzymatic activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
27% identity, 75% coverage: 6:315/413 of query aligns to 6:311/318 of 1wtcA
- active site: K52 (= K52), S77 (≠ A76), E203 (= E206), G207 (≠ A210), D209 (≠ S212), G231 (= G234), I302 (≠ T306), S303 (= S307)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ P20), K47 (≠ P47), M48 (≠ V48), A109 (≠ D108), A110 (≠ K109), Y114 (≠ F113)
- binding magnesium ion: E203 (= E206), G207 (≠ A210), D209 (≠ S212)
- binding pyridoxal-5'-phosphate: F51 (≠ Y51), K52 (= K52), N79 (= N78), G178 (= G181), G179 (= G182), G180 (= G183), G181 (= G184), G231 (= G234), E276 (= E280), T278 (≠ A282), S303 (= S307)
1v71A Crystal structure of s.Pombe serine racemase
27% identity, 75% coverage: 6:315/413 of query aligns to 6:311/318 of 1v71A
- active site: K52 (= K52), S77 (≠ A76), E203 (= E206), G207 (≠ A210), D209 (≠ S212), G231 (= G234), I302 (≠ T306), S303 (= S307)
- binding magnesium ion: E203 (= E206), G207 (≠ A210), D209 (≠ S212)
- binding pyridoxal-5'-phosphate: F51 (≠ Y51), K52 (= K52), N79 (= N78), G178 (= G181), G179 (= G182), G180 (= G183), G181 (= G184), G231 (= G234), E276 (= E280), T278 (≠ A282), S303 (= S307), G304 (= G308)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 75% coverage: 6:315/413 of query aligns to 11:316/323 of O59791
- S82 (≠ A76) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
27% identity, 75% coverage: 6:315/413 of query aligns to 7:312/319 of 2zr8A
- active site: K53 (= K52), S78 (≠ A76), E204 (= E206), G208 (≠ A210), D210 (≠ S212), G232 (= G234), I303 (≠ T306), S304 (= S307)
- binding magnesium ion: E204 (= E206), G208 (≠ A210), D210 (≠ S212)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y51), K53 (= K52), S77 (= S75), S78 (≠ A76), N80 (= N78), H81 (= H79), P147 (= P148), G179 (= G181), G180 (= G182), G181 (= G183), G182 (= G184), G232 (= G234), E277 (= E280), T279 (≠ A282), S304 (= S307)
- binding serine: S78 (≠ A76), R129 (≠ T130), D231 (= D233), G232 (= G234), A233 (= A235), Q234 (≠ A236), T235 (≠ V237)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
27% identity, 75% coverage: 6:315/413 of query aligns to 7:312/319 of 2zpuA
- active site: K53 (= K52), S78 (≠ A76), E204 (= E206), G208 (≠ A210), D210 (≠ S212), G232 (= G234), I303 (≠ T306), S304 (= S307)
- binding magnesium ion: E204 (= E206), G208 (≠ A210), D210 (≠ S212)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y51), K53 (= K52), S77 (= S75), S78 (≠ A76), N80 (= N78), H81 (= H79), P147 (= P148), G179 (= G181), G180 (= G182), G181 (= G183), G182 (= G184), G232 (= G234), E277 (= E280), T279 (≠ A282), S304 (= S307)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
28% identity, 75% coverage: 10:318/413 of query aligns to 26:334/339 of Q7XSN8
- E219 (= E206) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ S212) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
Q8VBT2 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Mus musculus (Mouse)
28% identity, 75% coverage: 13:320/413 of query aligns to 2:317/327 of Q8VBT2
- A2 (≠ S13) modified: N-acetylalanine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pwhA Rat liver l-serine dehydratase- complex with pyridoxyl-(o-methyl- serine)-5-monophosphate (see paper)
27% identity, 75% coverage: 13:322/413 of query aligns to 2:319/327 of 1pwhA
- active site: K41 (= K52), A65 (= A76), E194 (= E206), A198 (= A210), S200 (= S212), A222 (≠ G234), A269 (= A282), C303 (≠ T306)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-o-methyl-l-serine: F40 (≠ Y51), K41 (= K52), S64 (= S75), A65 (= A76), N67 (= N78), A68 (≠ H79), F136 (= F149), G168 (= G181), G169 (= G182), G170 (= G183), G171 (= G184), A222 (≠ G234), G224 (≠ A236), C303 (≠ T306), G304 (≠ S307)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
28% identity, 75% coverage: 4:313/413 of query aligns to 7:312/322 of 3l6bA
- active site: K54 (= K52), S77 (≠ A76), E203 (= E206), A207 (= A210), D209 (≠ S212), G232 (= G234), T278 (≠ P281), L305 (≠ T306), S306 (= S307)
- binding malonate ion: K54 (= K52), S76 (= S75), S77 (≠ A76), N79 (= N78), H80 (= H79), R128 (≠ F127), G232 (= G234)
- binding manganese (ii) ion: E203 (= E206), A207 (= A210), D209 (≠ S212)
- binding pyridoxal-5'-phosphate: F53 (≠ Y51), K54 (= K52), N79 (= N78), G178 (= G181), G179 (= G182), G180 (= G183), G181 (= G184), M182 (≠ L185), V233 (≠ A235), E276 (≠ L279), T278 (≠ P281), S306 (= S307), G307 (= G308)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
28% identity, 75% coverage: 4:312/413 of query aligns to 6:310/310 of 7nbgDDD
- active site: K53 (= K52), S76 (≠ A76), E202 (= E206), A206 (= A210), D208 (≠ S212), G231 (= G234), L304 (≠ T306), S305 (= S307)
- binding calcium ion: E202 (= E206), A206 (= A210), D208 (≠ S212)
- binding magnesium ion: N239 (≠ R243)
- binding ortho-xylene: S76 (≠ A76), Q81 (= Q81), I96 (= I96), Y113 (≠ F113)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N78 (= N78), G177 (= G181), G178 (= G182), G179 (= G183), G180 (= G184), M181 (≠ L185), G231 (= G234), V232 (≠ A235), E275 (≠ L279), T277 (≠ P281), S305 (= S307), G306 (= G308)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
28% identity, 75% coverage: 4:313/413 of query aligns to 6:316/322 of 7nbgAAA
- active site: K53 (= K52), S81 (≠ A76), E207 (= E206), A211 (= A210), D213 (≠ S212), G236 (= G234), L309 (≠ T306), S310 (= S307)
- binding calcium ion: E207 (= E206), A211 (= A210), D213 (≠ S212)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N78), G182 (= G181), G183 (= G182), G184 (= G183), G185 (= G184), M186 (≠ L185), G236 (= G234), V237 (≠ A235), T282 (≠ P281), S310 (= S307), G311 (= G308)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A76), G85 (≠ A80), Q86 (= Q81), I101 (= I96), K111 (= K106), I115 (≠ T110), Y118 (≠ F113)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
28% identity, 75% coverage: 4:313/413 of query aligns to 6:316/320 of 7nbhAAA
- active site: K53 (= K52), S81 (≠ A76), E207 (= E206), A211 (= A210), D213 (≠ S212), G236 (= G234), L309 (≠ T306), S310 (= S307)
- binding calcium ion: E207 (= E206), A211 (= A210), D213 (≠ S212)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A76), G85 (≠ A80), Q86 (= Q81), K111 (= K106), I115 (≠ T110), Y118 (≠ F113), D235 (= D233), P281 (≠ E280), N313 (= N310), V314 (≠ F311), D315 (= D312)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
28% identity, 75% coverage: 4:313/413 of query aligns to 6:316/323 of 7nbfAAA
- active site: K53 (= K52), S81 (≠ A76), E207 (= E206), A211 (= A210), D213 (≠ S212), G236 (= G234), L309 (≠ T306), S310 (= S307)
- binding calcium ion: E207 (= E206), A211 (= A210), D213 (≠ S212)
- binding magnesium ion: N244 (≠ R243)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N78), G182 (= G181), G183 (= G182), G184 (= G183), G185 (= G184), M186 (≠ L185), G236 (= G234), V237 (≠ A235), T282 (≠ P281), S310 (= S307), G311 (= G308)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ P20), L22 (≠ A21), T23 (= T22), P24 (= P23), L26 (≠ Q25), T27 (≠ M26), F46 (≠ L45)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
28% identity, 75% coverage: 4:313/413 of query aligns to 6:316/323 of 7nbdAAA
- active site: K53 (= K52), S81 (≠ A76), E207 (= E206), A211 (= A210), D213 (≠ S212), G236 (= G234), L309 (≠ T306), S310 (= S307)
- binding calcium ion: E207 (= E206), A211 (= A210), D213 (≠ S212)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ M271), L278 (≠ I277), V314 (≠ F311), L316 (≠ F313)
- binding magnesium ion: N244 (≠ R243)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N78), G182 (= G181), G183 (= G182), G184 (= G183), G185 (= G184), M186 (≠ L185), G236 (= G234), V237 (≠ A235), E280 (≠ L279), T282 (≠ P281), S310 (= S307), G311 (= G308)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
28% identity, 75% coverage: 4:313/413 of query aligns to 6:316/323 of 7nbcCCC
- active site: K53 (= K52), S81 (≠ A76), E207 (= E206), A211 (= A210), D213 (≠ S212), G236 (= G234), L309 (≠ T306), S310 (= S307)
- binding biphenyl-4-ylacetic acid: T78 (≠ C73), H79 (≠ A74), H84 (= H79), V148 (≠ L146), H149 (≠ S147), P150 (= P148)
- binding calcium ion: E207 (= E206), A211 (= A210), D213 (≠ S212)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N78), G182 (= G181), G183 (= G182), G184 (= G183), G185 (= G184), M186 (≠ L185), G236 (= G234), V237 (≠ A235), T282 (≠ P281), S310 (= S307), G311 (= G308)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
28% identity, 75% coverage: 4:313/413 of query aligns to 6:316/323 of 7nbcAAA
- active site: K53 (= K52), S81 (≠ A76), E207 (= E206), A211 (= A210), D213 (≠ S212), G236 (= G234), L309 (≠ T306), S310 (= S307)
- binding calcium ion: E207 (= E206), A211 (= A210), D213 (≠ S212)
- binding magnesium ion: N244 (≠ R243)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N78), G182 (= G181), G183 (= G182), G184 (= G183), G185 (= G184), M186 (≠ L185), G236 (= G234), V237 (≠ A235), T282 (≠ P281), S310 (= S307), G311 (= G308)
Sites not aligning to the query:
Query Sequence
>3610092 Dshi_3473 threonine dehydratase (RefSeq)
MTEFADNAHRAASAMRPLFPATPLQMNIHLSERYGAEIWLKREDLSPVRSYKIRGAFNAI
SKRVAEGQTQFACASAGNHAQGVAYACQHFGVHGVIFMPVTTPRQKIDKTRIFGGTAIDI
ELVGDYFDDTLAAAQRYCTEASATFLSPFDDADVIEGQSTVAVELLEQLEGPPDMVILPV
GGGGLSSGMKRYFEVCGVQVDLRLVEPCGARSLAKALETGAPQTLSKVDNFVDGAAVARI
GARPFEILRDVPPDHVLGAPEDRICHTMLEMLNVEGIVLEPAGALAVDVLDTLRDSITGK
RVVCVTSGGNFDFERLPEVKERSLRYAGLKKYFILRLPQRPGALKEFLGFLGPDDDIARF
EYLKKSARNFGSVLIGIETKDAGAFEQLFARLDAAGFPFRDITEDALLAEFLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory