Comparing 3610093 FitnessBrowser__Dino:3610093 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P12047 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; Glutamyl--tRNA ligase regulatory factor; EC 4.3.2.2 from Bacillus subtilis (strain 168) (see paper)
25% identity, 94% coverage: 14:340/348 of query aligns to 5:334/431 of P12047
2x75A Staphylococcus aureus adenylosuccinate lyase (see paper)
24% identity, 94% coverage: 14:340/348 of query aligns to 4:333/427 of 2x75A
Sites not aligning to the query:
A0A0K2JL82 Nitrosuccinate lyase; EC 4.3.99.5 from Streptomyces cremeus (see paper)
33% identity, 76% coverage: 79:341/348 of query aligns to 94:375/476 of A0A0K2JL82
Sites not aligning to the query:
5xnzA Crystal structure of cred complex with fumarate (see paper)
34% identity, 76% coverage: 79:341/348 of query aligns to 80:344/439 of 5xnzA
Sites not aligning to the query:
Q9X0I0 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
25% identity, 77% coverage: 22:288/348 of query aligns to 13:282/431 of Q9X0I0
Q05911 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 79% coverage: 14:288/348 of query aligns to 15:306/482 of Q05911
3oceA Crystal structure of fumarate lyase:delta crystallin from brucella melitensis bound to cobalt
26% identity, 53% coverage: 98:283/348 of query aligns to 134:332/461 of 3oceA
>3610093 FitnessBrowser__Dino:3610093
MAAGGQNRLFDGLFADPEIAALFSAETMFAHFRHYEMALTEAQGAVGRVKDAARIAARIA
KFEIAPDAISDRVTQDGVPVPAYVAALEAALGVDAAAVHLDATSQDLMDTSLALSLRRLS
EVLAARLDRVIVALDGLQAAQGARTLMGRTRMQAALPIPVATRLEAWQTPLLRARDRFPE
ARAGVEQLQFGGPVGQRSPQMAAIAERLAKALDLPPPGPVWHSTRDGVVGYGTWLALVTG
SLGKMGQDIALMSQQGLDDARLSGGGTSSAMPHKQNPIAAETLVTLARFNAVQIGGLHQA
MVHEQERSGAAWALEWMILPQICEATGAALRHAAALLDSIETLGKKPV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory