SitesBLAST
Comparing 3610165 FitnessBrowser__Dino:3610165 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P18079 5-aminolevulinate synthase; 5-aminolevulinic acid synthase; Delta-ALA synthase; Delta-aminolevulinate synthase; EC 2.3.1.37 from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) (see paper)
55% identity, 100% coverage: 1:404/404 of query aligns to 1:407/409 of P18079
- R21 (= R21) binding
- S137 (= S136) binding
- K156 (≠ V155) binding
- S189 (= S188) binding in other chain
- H217 (= H216) binding in other chain
- T245 (= T244) binding in other chain
- K248 (= K247) active site
- S277 (≠ T276) binding
- T278 (= T277) binding
- T365 (= T362) binding
2bwoB 5-aminolevulinate synthase from rhodobacter capsulatus in complex with succinyl-coa (see paper)
55% identity, 98% coverage: 1:396/404 of query aligns to 1:399/399 of 2bwoB
- active site: N54 (= N53), H142 (= H141), E185 (= E184), S189 (= S188), D214 (= D213), H217 (= H216), K248 (= K247)
- binding pyridoxal-5'-phosphate: S114 (= S113), A115 (≠ G114), Y116 (= Y115), H142 (= H141), E185 (= E184), S189 (= S188), D214 (= D213), V216 (= V215), H217 (= H216), T245 (= T244), K248 (= K247)
- binding succinyl-coenzyme a: R21 (= R21), T83 (= T82), N85 (= N84), S137 (= S136), S139 (≠ E138), H142 (= H141), I146 (= I145), K150 (≠ R149), K156 (≠ V155), I158 (= I157), F276 (= F275), F363 (≠ Y360), P364 (= P361), T365 (= T362)
2bwpA 5-aminolevulinate synthase from rhodobacter capsulatus in complex with glycine (see paper)
55% identity, 98% coverage: 1:394/404 of query aligns to 1:397/398 of 2bwpA
- active site: N54 (= N53), H142 (= H141), E185 (= E184), S189 (= S188), D214 (= D213), H217 (= H216), K248 (= K247)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: N54 (= N53), A115 (≠ G114), Y116 (= Y115), H142 (= H141), E185 (= E184), D214 (= D213), V216 (= V215), H217 (= H216), T245 (= T244), K248 (= K247), S277 (≠ T276), T278 (= T277)
P22557 5-aminolevulinate synthase, erythroid-specific, mitochondrial; ALAS-E; 5-aminolevulinic acid synthase 2; Delta-ALA synthase 2; Delta-aminolevulinate synthase 2; EC 2.3.1.37 from Homo sapiens (Human) (see 11 papers)
49% identity, 98% coverage: 1:394/404 of query aligns to 143:540/587 of P22557
- K156 (≠ L14) to E: in SIDBA1; significantly reduced activity
- R170 (= R28) to H: in SIDBA1; significantly increased thermosensitivity
- R204 (≠ Q60) to Q: in SIDBA1; 15% to 35% activity of wild-type; dbSNP:rs1338391423
- R218 (≠ Q74) to H: in SIDBA1; significantly increased thermosensitivity; dbSNP:rs185504937
- E242 (= E98) to K: in SIDBA1; significantly reduced activity
- C258 (≠ G114) binding in other chain
- F259 (≠ Y115) binding in other chain
- D263 (≠ W119) to N: in SIDBA1; significantly reduced activity
- P339 (= P195) to L: in SIDBA1; significantly reduced activity
- H360 (= H216) binding in other chain
- R375 (= R231) to C: in SIDBA1; significantly reduced activity
- T388 (= T244) binding in other chain
- K391 (= K247) modified: N6-(pyridoxal phosphate)lysine
- R411 (= R267) to C: in SIDBA1; 12% to 25% activity of wild-type; dbSNP:rs137852305; to H: in SIDBA1; significantly reduced activity
- T420 (= T276) binding
- T421 (= T277) binding
- R452 (≠ V306) to G: in SIDBA1; does not affect activity
- R511 (≠ K365) mutation to E: 2-fold increased enzyme activity with a lower specificity for glycine and higher for succinyl-CoA.
- P520 (= P374) to L: in SIDBA1; likely benign; associated in cis with H-560 in a patient; dbSNP:rs201062903
Sites not aligning to the query:
- 1:49 modified: transit peptide, Mitochondrion
- 560 R → H: in SIDBA1; associated in cis with L-520 in a patient; dbSNP:rs892041887
- 572 R → H: in SIDBA1; does not affect activity
- 586 Y → F: rare variant found in a congenital erythropoietic porphyria patient that also carries UROS mutations R-73 and Q-248; increased enzyme activity; dbSNP:rs139596860
P08680 5-aminolevulinate synthase, erythroid-specific, mitochondrial; ALAS-E; 5-aminolevulinic acid synthase 2; Delta-ALA synthase 2; Delta-aminolevulinate synthase 2; EC 2.3.1.37 from Mus musculus (Mouse) (see 2 papers)
48% identity, 98% coverage: 3:399/404 of query aligns to 145:545/587 of P08680
- K391 (= K247) modified: N6-(pyridoxal phosphate)lysine; mutation K->A,H: Abolishes enzyme activity.
Sites not aligning to the query:
- 1:49 modified: transit peptide, Mitochondrion
6hrhA Structure of human erythroid-specific 5'-aminolevulinate synthase, alas2
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 6hrhA
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), H218 (= H216), T246 (= T244), K249 (= K247), T278 (= T276), T279 (= T277)
5qreA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z117233350
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qreA
- binding pyridoxal-5'-phosphate: C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), T246 (= T244), K249 (= K247), T278 (= T276), T279 (= T277)
Sites not aligning to the query:
5qrcA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31721798
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qrcA
- binding 3-cyclohexyl-1-(morpholin-4-yl)propan-1-one: K129 (≠ A127), I130 (≠ R128), Y271 (≠ F269)
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), K249 (= K247), T278 (= T276), T279 (= T277)
5qraA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1101755952
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qraA
- binding [(4R)-4-methyl-2,3,4,5-tetrahydro-1H-azepin-1-yl](1,3-thiazol-4-yl)methanone: K129 (≠ A127), I130 (≠ R128), Y271 (≠ F269)
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), T246 (= T244), K249 (= K247), T278 (= T276), T279 (= T277)
5qr9A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31478129
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qr9A
- binding ethyl benzylcarbamate: H206 (≠ E204), L211 (≠ M209), D241 (≠ T239)
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), K249 (= K247), T278 (= T276), T279 (= T277)
5qr3A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z915492990
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qr3A
- binding 1-methyl-N-[(thiophen-2-yl)methyl]-1H-pyrazole-5-carboxamide: F7 (≠ M1)
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), K249 (= K247), T278 (= T276), T279 (= T277)
Sites not aligning to the query:
5qr1A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z396380540
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qr1A
- binding ~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-carboxamide: I130 (≠ R128), Y271 (≠ F269)
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), T246 (= T244), K249 (= K247), T278 (= T276), T279 (= T277)
5qr0A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z730649594
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qr0A
- binding N-[2-(4-hydroxyphenyl)ethyl]pyridine-2-carboxamide: H206 (≠ E204), L211 (≠ M209), D241 (≠ T239), T261 (≠ S259), L264 (= L262), E300 (= E296), A303 (= A299), A307 (≠ L303), P380 (= P376), H381 (≠ N377)
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), K249 (= K247), T278 (= T276), T279 (= T277)
5qqyA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434899
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qqyA
- binding 1-[(2,5-dihydrothiophen-3-yl)methyl]piperidin-4-ol: K16 (≠ Q10), E19 (≠ Q13), K129 (≠ A127), Y271 (≠ F269)
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), T246 (= T244), K249 (= K247), T278 (= T276), T279 (= T277)
Sites not aligning to the query:
5qqxA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z373768900
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qqxA
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), K249 (= K247), T278 (= T276), T279 (= T277)
Sites not aligning to the query:
5qqwA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z136583524
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qqwA
- binding 2-methyl-N-(pyridin-4-yl)furan-3-carboxamide: F125 (≠ S123), T126 (= T124), K129 (≠ A127)
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), T246 (= T244), K249 (= K247), T278 (= T276), T279 (= T277)
5qquA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1348371854
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qquA
- binding 5-(1,4-oxazepan-4-yl)pyridine-2-carbonitrile: Q65 (≠ K63), Q68 (≠ E66), R151 (= R149), N152 (≠ H150), G154 (≠ R152)
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), T246 (= T244), K249 (= K247), T278 (= T276), T279 (= T277)
5qqtA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434834
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qqtA
- binding N-(2,3-dimethylphenyl)-2-(morpholin-4-yl)acetamide: H206 (≠ E204), Q207 (≠ K205)
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), K249 (= K247), T278 (= T276), T279 (= T277)
5qqsA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z275151340
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qqsA
- binding 4-chloro-N-cyclopentyl-1-methyl-1H-pyrazole-3-carboxamide: H206 (≠ E204), G209 (= G207)
- binding pyridoxal-5'-phosphate: S115 (= S113), C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), T246 (= T244), K249 (= K247), T278 (= T276), T279 (= T277)
5qqqA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434857
49% identity, 98% coverage: 1:394/404 of query aligns to 7:398/429 of 5qqqA
- binding 3-[(thiomorpholin-4-yl)methyl]phenol: A210 (= A208), L211 (≠ M209), D241 (≠ T239), T261 (≠ S259)
- binding pyridoxal-5'-phosphate: C116 (≠ G114), F117 (≠ Y115), H143 (= H141), E186 (= E184), S190 (= S188), D215 (= D213), V217 (= V215), H218 (= H216), T246 (= T244), K249 (= K247), T278 (= T276), T279 (= T277)
Query Sequence
>3610165 FitnessBrowser__Dino:3610165
MDFDALFATQLNQLKEEGNYRIFAELERECGQHPKAQCHGEDGKRQITVWCSNDYLGMGQ
HPKVVERMQEVIGQCGAGAGGTRNISGTNHHHRLLEDELADLHGKEDALLFTSGYVSNWA
ALSTLGARLRDCVILSDELNHASMIEGMRHSRAKVVIWKHNDPADLEAKLAALPANCPKI
VAFESVYSMDGDIAPIAEICDVAEKYGAMTYLDEVHAVGMYGPRGAGIAERDGVMDRVTL
IEGTLGKAFGVVGGYITGSKTLCDFIRSFASGFIFTTALPPAVAAAAQTSIRHLKESSAE
RDLQKVRVAQLRQMLDRAGIPHIDNPSHIIPVMIKDPVKCRMLSDYLMDEFGIYVQPINY
PTVPKGTERLRFTPSPNHSVDDLRHLVSALEVLWKQCAISQAVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory