Comparing 3610196 FitnessBrowser__Dino:3610196 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
55% identity, 95% coverage: 4:286/298 of query aligns to 3:282/288 of 2ux8G
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
48% identity, 95% coverage: 6:288/298 of query aligns to 3:280/282 of 5ve7A
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
46% identity, 95% coverage: 6:287/298 of query aligns to 5:285/290 of 5i1fA
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
48% identity, 95% coverage: 4:286/298 of query aligns to 3:249/255 of 2ux8A
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
45% identity, 89% coverage: 5:269/298 of query aligns to 7:271/281 of 8f73E
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
43% identity, 96% coverage: 6:290/298 of query aligns to 2:289/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
43% identity, 96% coverage: 6:290/298 of query aligns to 2:289/290 of 6k8dA
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
44% identity, 91% coverage: 6:276/298 of query aligns to 2:264/264 of 3jukD
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
44% identity, 91% coverage: 6:276/298 of query aligns to 2:264/265 of 3jukA
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
45% identity, 96% coverage: 5:289/298 of query aligns to 1:286/291 of 8b6dA
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
42% identity, 96% coverage: 6:290/298 of query aligns to 2:284/285 of 6ikzB
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
44% identity, 96% coverage: 5:289/298 of query aligns to 1:281/286 of 8b68A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
40% identity, 99% coverage: 5:298/298 of query aligns to 2:297/299 of 2pa4B
O22287 Mannose-1-phosphate guanylyltransferase 1; GDP-mannose pyrophosphorylase 1; Protein CYTOKINESIS DEFECTIVE 1; Protein EMBRYO DEFECTIVE 101; Protein HYPERSENSITIVE TO AMMONIUM ION 1; Protein SENSITIVE TO OZONE 1; Protein VITAMIN C DEFECTIVE 1; EC 2.7.7.13 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
31% identity, 71% coverage: 9:221/298 of query aligns to 3:188/361 of O22287
Sites not aligning to the query:
7x8kB Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
31% identity, 71% coverage: 9:221/298 of query aligns to 3:188/367 of 7x8kB
7x8kA Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
30% identity, 71% coverage: 9:221/298 of query aligns to 3:187/365 of 7x8kA
Sites not aligning to the query:
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
25% identity, 80% coverage: 7:245/298 of query aligns to 4:212/295 of 6n0uA
7d73E Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
26% identity, 89% coverage: 9:272/298 of query aligns to 3:232/360 of 7d73E
7d72K Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
26% identity, 89% coverage: 9:272/298 of query aligns to 3:232/360 of 7d72K
7d72E Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
26% identity, 89% coverage: 9:272/298 of query aligns to 3:232/360 of 7d72E
>3610196 FitnessBrowser__Dino:3610196
MMSRSVKTAVFPVAGMGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIEEFIFVTS
RGKSALEDYFDAAPQLEQTLEDKGKTKLLEILRNTNMDSGAIAYVRQTRALGLGHAVWCA
RRLLGNEPFAVILPDDVIAAEKPCLAQMVEAYQELGGNMVATMEVPMDKASAYGIVDVEE
DMGSVVRVKGMIEKPKAEDAPSNLAVIGRYILSPEVLDNLDKGQIGAGGEIQLTDAIAQE
ITSKNNVYGFRFSGQRYDCGSKAGFLQATVSFALARPDLRDELSDFLQELAFARKAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory