Comparing 3610306 FitnessBrowser__Dino:3610306 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D5ARH0 Biotin transport ATP-binding protein BioM; ECF transporter A component BioM; EC 7.6.2.- from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) (see paper)
41% identity, 98% coverage: 2:218/221 of query aligns to 4:223/234 of D5ARH0
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
35% identity, 96% coverage: 1:212/221 of query aligns to 4:227/278 of 8bmsA
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
39% identity, 82% coverage: 29:209/221 of query aligns to 33:221/276 of Q5M243
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
35% identity, 96% coverage: 1:212/221 of query aligns to 5:227/278 of 8bmpA
5x40A Structure of a cbio dimer bound with amppcp (see paper)
36% identity, 92% coverage: 12:215/221 of query aligns to 16:230/280 of 5x40A
Sites not aligning to the query:
5d3mA Folate ecf transporter: amppnp bound state (see paper)
35% identity, 96% coverage: 1:212/221 of query aligns to 5:230/280 of 5d3mA
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
35% identity, 90% coverage: 14:213/221 of query aligns to 20:233/280 of Q5M244
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
33% identity, 91% coverage: 2:203/221 of query aligns to 5:210/249 of 4hluC
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
32% identity, 91% coverage: 2:203/221 of query aligns to 4:206/247 of 4zirB
4zirA Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
33% identity, 92% coverage: 17:219/221 of query aligns to 23:230/263 of 4zirA
Sites not aligning to the query:
4hluA Structure of the ecfa-a' heterodimer bound to adp (see paper)
33% identity, 92% coverage: 17:219/221 of query aligns to 23:232/265 of 4hluA
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 91% coverage: 8:209/221 of query aligns to 12:225/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 91% coverage: 8:209/221 of query aligns to 12:225/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 91% coverage: 8:209/221 of query aligns to 12:225/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
33% identity, 91% coverage: 8:209/221 of query aligns to 12:225/353 of Q97UY8
8bmpB Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
35% identity, 90% coverage: 17:215/221 of query aligns to 22:234/281 of 8bmpB
Sites not aligning to the query:
5d3mB Folate ecf transporter: amppnp bound state (see paper)
35% identity, 90% coverage: 17:215/221 of query aligns to 22:234/281 of 5d3mB
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
33% identity, 94% coverage: 3:209/221 of query aligns to 12:218/371 of P68187
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
33% identity, 94% coverage: 3:209/221 of query aligns to 11:217/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
33% identity, 94% coverage: 3:209/221 of query aligns to 11:217/371 of 3puxA
>3610306 FitnessBrowser__Dino:3610306
MLSFSQVVVEKGGRPILSDINIDLNEKRIGIIGRNGSGKSTFARLFNGLEKPSSGSITLE
GSAELKDLRRKVGFVFQNPDNQIVYPIVDEDLAFGLKNLKLPSATIKERITEVMARFQIE
HLKDRLTHQLSGGERQMVALAGVLVMQPQMIVFDEPTTLLDLWNKKRLMRAIADLKEHVV
LVSHDLDLLREFDRVIHIEAGRIVGDGEPNAVIGDYIARSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory