SitesBLAST
Comparing 3610331 FitnessBrowser__Dino:3610331 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
52% identity, 98% coverage: 3:248/252 of query aligns to 2:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), Q15 (= Q16), G16 (= G17), I17 (= I18), D36 (= D37), V63 (= V62), N89 (= N88), A91 (= A90), S94 (≠ A93), I142 (= I141), S143 (≠ A142), S144 (= S143), Y157 (= Y156), K161 (= K160), P187 (= P186), H188 (≠ G187), I190 (≠ V189), I194 (≠ V195)
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
41% identity, 99% coverage: 3:252/252 of query aligns to 2:247/247 of 2ewmB
- active site: G16 (= G17), S139 (= S143), Y149 (≠ F153), Y152 (= Y156), K156 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), N15 (≠ Q16), G16 (= G17), I17 (= I18), D36 (= D37), L37 (≠ I38), C59 (≠ T60), D60 (= D61), V61 (= V62), N87 (= N88), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), S183 (≠ G187), L184 (= L188), V185 (= V189), T189 (≠ Q193)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
41% identity, 99% coverage: 3:252/252 of query aligns to 4:249/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
41% identity, 99% coverage: 3:252/252 of query aligns to 3:247/247 of 3rwbA
- active site: G17 (= G17), S140 (= S143), Y153 (= Y156), K157 (= K160)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S143), N141 (≠ G144), T142 (= T145), M150 (≠ F153), Y153 (= Y156), L185 (= L188), H196 (≠ E199)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), Q16 (= Q16), G17 (= G17), I18 (= I18), D37 (= D37), I38 (= I38), D60 (= D61), I61 (≠ V62), N87 (= N88), A88 (= A89), S89 (≠ A90), I138 (= I141), S140 (= S143), Y153 (= Y156), K157 (= K160), P183 (= P186), L185 (= L188), I186 (≠ V189), S188 (= S191), G190 (≠ Q193), V191 (= V194)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
41% identity, 99% coverage: 3:252/252 of query aligns to 3:247/247 of 3ndrA
- active site: G17 (= G17), S140 (= S143), Y153 (= Y156), K157 (= K160)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), Q16 (= Q16), G17 (= G17), I18 (= I18), D37 (= D37), I38 (= I38), D60 (= D61), I61 (≠ V62), N87 (= N88), A88 (= A89), S89 (≠ A90), V110 (= V114), I138 (= I141), S140 (= S143), Y153 (= Y156), K157 (= K160), P183 (= P186), L185 (= L188), I186 (≠ V189), S188 (= S191), G190 (≠ Q193), V191 (= V194)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 100% coverage: 1:251/252 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (= N115), S139 (= S143), Q149 (≠ F153), Y152 (= Y156), K156 (= K160)
- binding acetoacetyl-coenzyme a: D93 (≠ A97), K98 (≠ D102), S139 (= S143), N146 (≠ T150), V147 (≠ P151), Q149 (≠ F153), Y152 (= Y156), F184 (≠ L188), M189 (≠ Q193), K200 (= K203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ Q16), G18 (= G17), I19 (= I18), D38 (= D37), F39 (≠ I38), V59 (≠ T60), D60 (= D61), V61 (= V62), N87 (= N88), A88 (= A89), G89 (≠ A90), I90 (= I91), T137 (≠ I141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), F184 (≠ L188), T185 (≠ V189), T187 (≠ S191), M189 (≠ Q193)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
40% identity, 97% coverage: 4:248/252 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ Q16) binding
- D36 (= D37) binding
- D62 (= D61) binding
- I63 (≠ V62) binding
- N89 (= N88) binding
- Y153 (= Y156) binding
- K157 (= K160) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
39% identity, 98% coverage: 4:251/252 of query aligns to 2:244/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), M16 (≠ I18), D35 (= D37), I36 (= I38), I62 (≠ V62), N88 (= N88), G90 (≠ A90), I138 (= I141), S140 (= S143), Y152 (= Y156), K156 (= K160), I185 (≠ V189)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
40% identity, 97% coverage: 7:251/252 of query aligns to 2:251/253 of 4nbwA
- active site: G12 (= G17), S146 (= S143), Y159 (= Y156), K163 (= K160)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), N11 (≠ Q16), G12 (= G17), I13 (= I18), D32 (= D37), L33 (≠ I38), V57 (≠ T60), D58 (= D61), V59 (= V62), N85 (= N88), A86 (= A89), G87 (≠ A90), S146 (= S143), Y159 (= Y156), K163 (= K160), I192 (≠ V189), T194 (≠ S191)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
34% identity, 98% coverage: 4:251/252 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G17), S142 (= S143), Q152 (≠ F153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ A15), R15 (≠ Q16), G16 (= G17), I17 (= I18), N35 (≠ A36), Y36 (≠ L39), N37 (≠ D40), G38 (= G41), S39 (≠ N42), N63 (≠ D61), V64 (= V62), N90 (= N88), A91 (= A89), I93 (= I91), I113 (≠ V114), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (≠ V189), T190 (≠ S191)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
35% identity, 98% coverage: 2:248/252 of query aligns to 1:236/239 of 4nbtA
- active site: G16 (= G17), S132 (= S143), Y145 (= Y156), K149 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), K15 (≠ Q16), G16 (= G17), L17 (≠ I18), D36 (= D37), L37 (≠ I38), L52 (≠ T60), N53 (≠ D61), V54 (= V62), N80 (= N88), A81 (= A89), G82 (≠ A90), I130 (= I141), S132 (= S143), Y145 (= Y156), K149 (= K160), P177 (= P186), G178 (= G187), I180 (≠ V189), T182 (≠ S191)
5ha5D Crystal structure of an NAD-bound oxidoreductase from brucella ovis
34% identity, 98% coverage: 1:248/252 of query aligns to 1:240/244 of 5ha5D
- active site: G17 (= G17), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), R16 (≠ Q16), G17 (= G17), L18 (≠ I18), D37 (= D37), I38 (= I38), L62 (≠ T60), D63 (= D61), V64 (= V62), N90 (= N88), A91 (= A89), S142 (= S143), Y155 (= Y156), K159 (= K160), G186 (= G187), M188 (≠ V189), S190 (= S191)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
35% identity, 97% coverage: 4:248/252 of query aligns to 8:243/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G13), D19 (≠ A15), L22 (≠ I18), I42 (= I38), D65 (= D61), M66 (≠ V62), N92 (= N88), A93 (= A89), G94 (≠ A90), L115 (≠ V114), I143 (= I141), S145 (= S143), Y158 (= Y156), K162 (= K160), G189 (= G187), M191 (≠ V189), T193 (≠ S191), N195 (≠ Q193)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
35% identity, 99% coverage: 3:251/252 of query aligns to 5:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G13), R18 (≠ Q16), G19 (= G17), I20 (= I18), D39 (= D37), R40 (≠ I38), C63 (≠ T60), I65 (≠ V62), N91 (= N88), G93 (≠ A90), I94 (= I91), V114 (= V114), Y155 (= Y156), K159 (= K160), I188 (≠ V189), T190 (≠ S191), T193 (≠ V194)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
36% identity, 98% coverage: 1:248/252 of query aligns to 6:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (≠ A15), K21 (≠ Q16), G22 (= G17), I23 (= I18), A43 (vs. gap), S44 (≠ A36), S45 (≠ D37), G68 (≠ T60), D69 (= D61), V70 (= V62), N96 (= N88), S97 (≠ A89), G98 (≠ A90), Y100 (≠ W92), I144 (= I141), S146 (= S143), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), M191 (≠ L188), I192 (≠ V189), T194 (≠ S191), G196 (≠ Q193), T197 (≠ V194)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S143), Y159 (= Y156), M191 (≠ L188), I202 (≠ E199)
7x5jC Acp-dependent oxoacyl reductase
34% identity, 97% coverage: 4:248/252 of query aligns to 2:250/256 of 7x5jC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ A15), G15 (= G17), L16 (≠ I18), N36 (vs. gap), R37 (vs. gap), N38 (≠ D37), D62 (= D61), V63 (= V62), N89 (= N88), A90 (= A89), A91 (= A90), V114 (= V114), I141 (= I141), Y156 (= Y156), K160 (= K160), L186 (≠ P186), G187 (= G187), V188 (≠ L188), R194 (≠ E192), S197 (≠ V195), S198 (≠ A196)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
35% identity, 98% coverage: 3:250/252 of query aligns to 3:238/244 of 1nfqA
- active site: G17 (= G17), S139 (= S143), Y152 (= Y156), K156 (= K160)
- binding Androsterone: L91 (= L95), E141 (≠ T145), C149 (≠ F153), Y152 (= Y156), V193 (≠ S197), I197 (≠ L201), F198 (≠ E202)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ Q16), G17 (= G17), M18 (≠ I18), D37 (= D37), L39 (= L39), L59 (≠ T60), D60 (= D61), V61 (= V62), N87 (= N88), A88 (= A89), I137 (= I141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), V185 (= V189), T187 (≠ S191), P188 (≠ E192), M189 (≠ Q193), T190 (≠ V194)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
35% identity, 98% coverage: 3:250/252 of query aligns to 3:238/244 of 1nffA
- active site: G17 (= G17), S139 (= S143), Y152 (= Y156), K156 (= K160)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), R16 (≠ Q16), G17 (= G17), M18 (≠ I18), D37 (= D37), I38 (= I38), L39 (= L39), L59 (≠ T60), D60 (= D61), V61 (= V62), N87 (= N88), A88 (= A89), G89 (≠ A90), I90 (= I91), I137 (= I141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), V185 (= V189), T187 (≠ S191), P188 (≠ E192), M189 (≠ Q193), T190 (≠ V194)
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 98% coverage: 3:250/252 of query aligns to 4:239/260 of P9WGT1
- I6 (≠ D5) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ QGI 16:18) binding
- D38 (= D37) binding
- V47 (≠ R47) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (= DV 61:62) binding
- T69 (≠ A69) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N88) binding
- S140 (= S143) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y156) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K160) binding
- 183:191 (vs. 186:194, 44% identical) binding
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
34% identity, 98% coverage: 4:251/252 of query aligns to 6:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ A15), R18 (≠ Q16), I20 (= I18), T40 (≠ S46), N62 (≠ D61), V63 (= V62), N89 (= N88), A90 (= A89), I92 (= I91), V139 (≠ I141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), I187 (≠ V189), T189 (≠ S191), M191 (≠ Q193)
Query Sequence
>3610331 FitnessBrowser__Dino:3610331
MPRLDGKVAIITGAAQGIGAVYAQALADEGAKVMIADILDGNPTASRISAQGGTADFMQT
DVSDESSVAAMVDATVAKWGGVDILINNAAIWASLRAKPFEDISPEEWDKLMAVNVKGPF
LCARAVVPHMRAGKYGRIVNIASGTAYKGTPNFLHYVTSKGAVIAMTRALAREVGEDGIT
VNTLAPGLVLSEQVVASPELLEKLSAPVMASRAIKRDQLPQDLVGPLLFLVSDDAAFMTG
EVTVIDGGSVMH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory