SitesBLAST
Comparing 3610340 FitnessBrowser__Dino:3610340 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
55% identity, 88% coverage: 12:159/169 of query aligns to 6:152/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (= I46), C42 (= C48), E43 (= E49), G45 (= G51), C47 (= C53), G48 (= G54), C50 (= C56), R60 (= R66), C62 (= C68), C101 (= C108), G102 (= G109), C104 (= C111), C136 (= C143), C138 (= C145)
- binding pterin cytosine dinucleotide: Q100 (= Q107), C138 (= C145)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
48% identity, 90% coverage: 12:163/169 of query aligns to 6:157/166 of P19921
- C42 (= C48) binding
- C47 (= C53) binding
- C50 (= C56) binding
- C62 (= C68) binding
- C102 (= C108) binding
- C105 (= C111) binding
- C137 (= C143) binding
- C139 (= C145) binding
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
48% identity, 90% coverage: 12:163/169 of query aligns to 4:155/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G51), H44 (≠ V52)
- binding fe2/s2 (inorganic) cluster: I38 (= I46), G39 (= G47), C40 (= C48), S43 (≠ G51), C45 (= C53), G46 (= G54), C48 (= C56), C60 (= C68), C100 (= C108), G101 (= G109), C103 (= C111), C135 (= C143), C137 (= C145)
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
48% identity, 90% coverage: 12:163/169 of query aligns to 4:155/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ G51), H44 (≠ V52)
- binding fe2/s2 (inorganic) cluster: C40 (= C48), S43 (≠ G51), C45 (= C53), G46 (= G54), C48 (= C56), C60 (= C68), C100 (= C108), G101 (= G109), C103 (= C111), C135 (= C143), C137 (= C145)
- binding pterin cytosine dinucleotide: Q99 (= Q107), C137 (= C145)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
45% identity, 96% coverage: 1:162/169 of query aligns to 1:160/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C48), S50 (≠ G51), C52 (= C53), G53 (= G54), C55 (= C56), C67 (= C68), C106 (= C108), G107 (= G109), C109 (= C111), C141 (= C143), C143 (= C145)
- binding pterin cytosine dinucleotide: Q105 (= Q107), C143 (= C145)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
49% identity, 91% coverage: 12:164/169 of query aligns to 4:155/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (= I46), C40 (= C48), S43 (≠ G51), C45 (= C53), G46 (= G54), C48 (= C56), C60 (= C68), C99 (= C108), G100 (= G109), C102 (= C111), C134 (= C143), C136 (= C145)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q107), C136 (= C145)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
49% identity, 91% coverage: 12:164/169 of query aligns to 5:156/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C48), S44 (≠ G51), H45 (≠ V52), C46 (= C53), G47 (= G54), C49 (= C56), C61 (= C68), C100 (= C108), G101 (= G109), C103 (= C111), C135 (= C143), C137 (= C145)
7dqxC Crystal structure of xanthine dehydrogenase family protein
51% identity, 85% coverage: 16:158/169 of query aligns to 10:152/160 of 7dqxC
- binding fe2/s2 (inorganic) cluster: C42 (= C48), G45 (= G51), V46 (= V52), C47 (= C53), C50 (= C56), R60 (= R66), C62 (= C68), Q100 (= Q107), C101 (= C108), C104 (= C111), C137 (= C143), C139 (= C145)
- binding pterin cytosine dinucleotide: Q100 (= Q107), C139 (= C145)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
44% identity, 89% coverage: 9:159/169 of query aligns to 2:151/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ I46), C41 (= C48), G44 (= G51), C46 (= C53), G47 (= G54), C49 (= C56), C61 (= C68), C100 (= C108), G101 (= G109), C103 (= C111), C135 (= C143), C137 (= C145)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q107), C137 (= C145)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
41% identity, 91% coverage: 14:167/169 of query aligns to 6:164/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ I46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C108), G101 (= G109), C103 (= C111), C137 (= C143), C139 (= C145)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q107), C139 (= C145)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
41% identity, 91% coverage: 14:167/169 of query aligns to 6:164/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ I46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C108), G101 (= G109), C103 (= C111), C137 (= C143), C139 (= C145)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q107), C139 (= C145)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
41% identity, 91% coverage: 14:167/169 of query aligns to 6:164/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ I46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C108), G101 (= G109), C103 (= C111), C137 (= C143), C139 (= C145)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q107), C139 (= C145)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
41% identity, 91% coverage: 14:167/169 of query aligns to 6:164/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C108), G101 (= G109), C103 (= C111), C137 (= C143), C139 (= C145)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q107), C139 (= C145)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
41% identity, 91% coverage: 14:167/169 of query aligns to 6:164/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ I46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C108), G101 (= G109), C103 (= C111), C137 (= C143), C139 (= C145)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q107), C139 (= C145)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
41% identity, 91% coverage: 14:167/169 of query aligns to 6:164/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (≠ I46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C108), G101 (= G109), C103 (= C111), C137 (= C143), C139 (= C145)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q107), C139 (= C145)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding glycerol: 416, 535, 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
41% identity, 91% coverage: 14:167/169 of query aligns to 6:164/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (≠ I46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), Q99 (= Q107), C100 (= C108), G101 (= G109), C103 (= C111), C137 (= C143), C139 (= C145)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q107), C139 (= C145)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 535, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
41% identity, 91% coverage: 14:167/169 of query aligns to 6:164/907 of Q46509
- C40 (= C48) binding
- C45 (= C53) binding
- C48 (= C56) binding
- C60 (= C68) binding
- C100 (= C108) binding
- C103 (= C111) binding
- C137 (= C143) binding
- C139 (= C145) binding
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
41% identity, 90% coverage: 8:159/169 of query aligns to 1:152/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G47), C41 (= C48), D42 (≠ E49), G44 (= G51), C46 (= C53), G47 (= G54), C49 (= C56), C61 (= C68), C101 (= C108), G102 (= G109), C104 (= C111), C136 (= C143), C138 (= C145)
- binding pterin cytosine dinucleotide: Q100 (= Q107), C138 (= C145)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
39% identity, 93% coverage: 6:163/169 of query aligns to 57:228/229 of P77165
- C99 (= C48) binding
- C104 (= C53) binding
- G105 (= G54) binding
- C107 (= C56) binding
- C119 (= C68) binding
- C158 (= C108) binding
- C161 (= C111) binding
- C208 (= C143) binding
- C210 (= C145) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
40% identity, 91% coverage: 6:159/169 of query aligns to 6:173/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (= G47), C48 (= C48), D49 (≠ E49), G51 (= G51), C53 (= C53), G54 (= G54), C56 (= C56), C68 (= C68), C107 (= C108), G108 (= G109), C110 (= C111), C157 (= C143), C159 (= C145)
Query Sequence
>3610340 FitnessBrowser__Dino:3610340
MRRLTATERHPVRFTLNGKPAEGTAHPRMLLSDFLRGVQGATGTHIGCEHGVCGACTVRI
DGAMARSCLTFAVQIEGAEIDTVEALAPAPARLSILQDAFRKHHALQCGFCTPGILMSLD
TLLATEPRADAGRIRDVLSGHLCRCTGYQPIVAAALDAAQTLREETDNA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory