SitesBLAST
Comparing 3610403 FitnessBrowser__Dino:3610403 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
39% identity, 90% coverage: 16:291/305 of query aligns to 21:300/478 of Q47945
- Q37 (≠ P33) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
40% identity, 83% coverage: 40:291/305 of query aligns to 1:251/413 of 8jejC
- binding heme c: C13 (= C52), C16 (= C55), H17 (= H56), T42 (≠ P82), I44 (≠ L84), F60 (= F100), L64 (≠ V104), L75 (≠ Y115), Y76 (= Y116), M79 (≠ F119), P80 (= P120), Y84 (= Y124), R122 (= R161), C162 (= C200), C165 (= C203), H166 (= H204), I186 (≠ L225), W189 (≠ S229), A191 (= A231), P192 (= P232), I194 (= I234), W205 (= W244), Y213 (≠ A252), R223 (≠ D262), M228 (= M268)
- binding ubiquinone-10: M36 (≠ F76), P77 (= P117), S124 (≠ G163), W128 (= W167), C165 (= C203), L173 (≠ G211)
Sites not aligning to the query:
- binding heme c: 303, 304, 307, 308, 320, 321, 323, 327, 328, 336, 341, 345, 347, 354, 356, 359, 376
- binding ubiquinone-10: 408, 411
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
40% identity, 83% coverage: 40:291/305 of query aligns to 1:251/418 of 7w2jC
- binding heme c: C13 (= C52), C16 (= C55), H17 (= H56), T42 (≠ P82), I44 (≠ L84), Y55 (≠ W95), L75 (≠ Y115), Y76 (= Y116), A78 (≠ S118), M79 (≠ F119), R122 (= R161), H161 (= H199), C162 (= C200), C165 (= C203), H166 (= H204), A191 (= A231), P192 (= P232), R223 (≠ D262), P227 (≠ S267), M228 (= M268)
Sites not aligning to the query:
- binding heme c: 289, 290, 293, 294, 305, 306, 307, 309, 312, 313, 314, 322, 327, 331, 333, 340, 342, 343, 345
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
40% identity, 84% coverage: 35:291/305 of query aligns to 1:262/433 of 8gy2B
- binding heme c: C18 (= C52), C21 (= C55), H22 (= H56), T46 (≠ P82), I48 (≠ L84), Y59 (≠ W95), L68 (≠ V104), R73 (≠ G109), V79 (≠ Y115), Y80 (= Y116), M83 (≠ F119), F88 (≠ Y124), R126 (= R161), H165 (= H199), C166 (= C200), C169 (= C203), H170 (= H204), I201 (vs. gap), A202 (= A231), P203 (= P232), L205 (≠ I234), W216 (= W244), F224 (≠ A252), A234 (≠ D262), V235 (≠ A263), F236 (= F264), F236 (= F264), M239 (= M268)
- binding ubiquinone-10: C21 (= C55), L34 (≠ A70), P39 (= P75), P81 (= P117), L129 (= L164), W132 (= W167), E168 (≠ A202), R173 (= R207), I197 (vs. gap), D241 (≠ E270)
Sites not aligning to the query:
- binding heme c: 301, 302, 305, 306, 316, 317, 318, 320, 324, 342, 352, 354, 356, 359, 375, 428
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
33% identity, 93% coverage: 11:295/305 of query aligns to 3:296/440 of 8gy3A
- binding heme c: Y52 (≠ G51), C53 (= C52), C56 (= C55), H57 (= H56), S84 (≠ P82), I86 (≠ L84), W97 (= W95), F102 (= F100), L117 (≠ Y115), F121 (= F119), F126 (≠ Y124), R163 (= R161), C203 (= C200), C206 (= C203), H207 (= H204), A232 (= A231), P233 (= P232), L235 (≠ I234), W245 (= W244), Y253 (≠ A252), L254 (= L253), G263 (≠ D262), S264 (≠ A263), M269 (= M268), Y292 (≠ L291)
- binding ubiquinone-10: E55 (≠ A54), T76 (= T74), F78 (= F76), Y118 (= Y116), P119 (= P117), I160 (≠ F158), G166 (= G163), Q167 (≠ L164), F169 (≠ L166), W170 (= W167), H202 (= H199), R210 (= R207), L213 (≠ A210)
Sites not aligning to the query:
- binding heme c: 337, 340, 341, 353, 355, 358, 359, 372, 377, 382, 383, 386, 388, 391
Query Sequence
>3610403 FitnessBrowser__Dino:3610403
MRRFLTLVSGAAVLGAASLGVVIAWPVGSAVTPIAIEGNVDRGAYLARASGCIACHTNFE
AGGAPLAGGAPLETPFGTFYPPNLTTDPEHGMGEWTAEQFAKAVRQGIGPDGTPYYPSFP
YTFYADFSDQDIADLWAAFQTVPPVDEPAPENDVSFPFDQRWGLKLWRAAFFYDPDTEPI
EGRSDAWNRGRELVRGAAHCGACHTPRNLAGGRDIGASFAGNAQLPGGSKAPAIRPKDLV
KNDWTVSNLAYALQTGITPSGDAFGGSMAEVVREGTRFLTPADREAMALFLLNKDTVEAE
NPASN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory