SitesBLAST
Comparing 3610430 FitnessBrowser__Dino:3610430 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
5ti1H Crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
54% identity, 98% coverage: 6:411/413 of query aligns to 14:430/430 of 5ti1H
- active site: D139 (= D121), H146 (= H128), E212 (= E194), E214 (= E196), D246 (= D228), R250 (= R232), Q253 (= Q235), K266 (= K248), T270 (= T252), E377 (= E358)
- binding magnesium ion: D139 (= D121), E212 (= E194), E214 (= E196), D246 (= D228)
P16930 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Homo sapiens (Human) (see 14 papers)
50% identity, 98% coverage: 7:409/413 of query aligns to 2:415/419 of P16930
- S2 (= S7) modified: N-acetylserine
- N16 (= N23) to I: in TYRSN1; loss of activity; dbSNP:rs121965073
- A35 (= A40) to T: in TYRSN1; atypical mild phenotype
- F62 (= F62) to C: in TYRSN1; loss of activity
- A134 (= A129) to D: in TYRSN1; loss of activity; dbSNP:rs121965074
- C193 (= C188) to R: in TYRSN1; loss of activity
- D233 (= D228) to V: in TYRSN1; loss of activity; dbSNP:rs80338897
- W234 (= W229) to G: in TYRSN1; loss of activity; dbSNP:rs1555441595
- Q279 (≠ R274) to R: in TYRSN1; may affect splicing resulting in skipping of exon 8 alone or together with exon 9; lower activity as compared to wild type; dbSNP:rs121965078
- R341 (= R335) to W: does not cause a clinically relevant phenotype; results in lower enzyme activity; dbSNP:rs11555096
- P342 (≠ T336) to L: in TYRSN1; loss of activity; dbSNP:rs779040832
- R381 (= R375) to G: in TYRSN1; loss of activity; dbSNP:rs121965077
- F405 (= F399) to H: in TYRSN1; requires 2 nucleotide substitutions
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P35505 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Mus musculus (Mouse) (see 3 papers)
48% identity, 98% coverage: 7:409/413 of query aligns to 2:415/419 of P35505
- D126 (= D121) binding
- E199 (= E194) binding
- E201 (= E196) binding ; mutation to G: Decrease in activity.
- D233 (= D228) binding ; binding
- K253 (= K248) binding
- T257 (= T252) binding
2hzyA Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate (see paper)
48% identity, 98% coverage: 7:409/413 of query aligns to 2:415/416 of 2hzyA
- active site: D126 (= D121), H133 (= H128), E199 (= E194), E201 (= E196), D233 (= D228), R237 (= R232), Q240 (= Q235), K253 (= K248), T257 (= T252), E364 (= E358)
- binding calcium ion: G122 (≠ A117), D123 (≠ E118)
- binding manganese (ii) ion: D126 (= D121), E199 (= E194), E201 (= E196), D233 (= D228)
1qcoA Crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate (see paper)
48% identity, 98% coverage: 7:409/413 of query aligns to 2:415/416 of 1qcoA
- active site: K253 (= K248)
- binding acetoacetic acid: D126 (= D121), F127 (= F122), Y128 (= Y123), H133 (= H128), Y159 (= Y154), E199 (= E194), K253 (= K248), G349 (= G343), T350 (= T344)
- binding calcium ion: D126 (= D121), E199 (= E194), E201 (= E196), D233 (= D228)
- binding fumaric acid: Y128 (= Y123), V137 (= V132), R142 (= R137), Q240 (= Q235), Y244 (= Y239)
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
48% identity, 98% coverage: 7:409/413 of query aligns to 4:417/419 of 1hyoB
- active site: D128 (= D121), H135 (= H128), E201 (= E194), E203 (= E196), D235 (= D228), R239 (= R232), Q242 (= Q235), K255 (= K248), T259 (= T252), E366 (= E358)
- binding acetate ion: Y130 (= Y123), V139 (= V132), R144 (= R137)
- binding calcium ion: D128 (= D121), E201 (= E194), E203 (= E196), D235 (= D228)
- binding 4-[hydroxy-[methyl-phosphinoyl]]-3-oxo-butanoic acid: D128 (= D121), F129 (= F122), Y130 (= Y123), H135 (= H128), Y161 (= Y154), K255 (= K248), G351 (= G343), T352 (= T344)
- binding magnesium ion: D235 (= D228), W236 (= W229), K255 (= K248), G258 (≠ A251), T259 (= T252)
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
28% identity, 42% coverage: 178:352/413 of query aligns to 106:248/277 of 6iymA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
29% identity, 27% coverage: 125:235/413 of query aligns to 68:155/269 of 4dbhA
Sites not aligning to the query:
Query Sequence
>3610430 FitnessBrowser__Dino:3610430
MSGLIHSWVPGANDPAGAFPLNNLAFGVFSTGDGPRCAVAIGDKVLDLAALQAAGLLPDH
GFDAPALDTFMGRGQPAWQAVREALTELLRAGAETAPVRAALHDRAGVRLHLPFTLAEFT
DFYAGRQHAFNVGSLFRDPANALPPNWLHMPIGYNGRASTVVVSGTPIHRPAGQIKDPSD
PMPRFGPCERLDFELELGAVVGTPSQMGVPVTVDEADEMIFGYVLLNDWSARDIQAWEYV
PLGPFQGKAFATTISPWVVPRAALAPFRCGPPVREVPLLPHLRDTGPMFHDIDLAVTLAP
PGGAPTEVCRTNSNALYYSAAQLLAHHSTSGCAMRTGDLLGSGTISGPEKGMFGSLLEIT
WGGRDPVALAGGATRRFLADGDTVTLKGEARGDGYRIGFGTCTGTILPAPKRP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory