Comparing 3610441 FitnessBrowser__Dino:3610441 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
27% identity, 84% coverage: 53:352/356 of query aligns to 487:751/753 of 6laaA
Sites not aligning to the query:
7ylrA Structure of a bacteria protein
29% identity, 79% coverage: 71:352/356 of query aligns to 82:325/326 of 7ylrA
Sites not aligning to the query:
6kbhA Crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase
27% identity, 88% coverage: 7:321/356 of query aligns to 456:732/765 of 6kbhA
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
28% identity, 66% coverage: 7:242/356 of query aligns to 105:329/333 of 5ogxA
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
28% identity, 66% coverage: 7:242/356 of query aligns to 106:330/334 of P0DPQ8
Sites not aligning to the query:
7fixR1 Photosystem I reaction center subunit PsaK (see paper)
41% identity, 23% coverage: 271:353/356 of query aligns to 8:90/97 of 7fixR1
6khi1 Supercomplex for cylic electron transport in cyanobacteria (see paper)
41% identity, 23% coverage: 271:353/356 of query aligns to 9:91/98 of 6khi1
1rfkB Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus (see paper)
41% identity, 23% coverage: 274:354/356 of query aligns to 12:92/97 of 1rfkB
7s3dX Structure of photosystem i with bound ferredoxin from synechococcus sp. Pcc 7335 acclimated to far-red light (see paper)
46% identity, 20% coverage: 285:354/356 of query aligns to 22:91/97 of 7s3dX
3ab5A Crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae
41% identity, 20% coverage: 285:354/356 of query aligns to 22:91/97 of 3ab5A
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
27% identity, 65% coverage: 12:242/356 of query aligns to 158:390/396 of 1gvhA
Sites not aligning to the query:
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 65% coverage: 12:242/356 of query aligns to 158:390/396 of P24232
Sites not aligning to the query:
1pfdA The solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures (see paper)
39% identity, 24% coverage: 271:354/356 of query aligns to 8:90/96 of 1pfdA
3b2gA Leptolyngbya boryana ferredoxin (see paper)
38% identity, 23% coverage: 274:354/356 of query aligns to 12:92/98 of 3b2gA
1ewyC Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
38% identity, 23% coverage: 274:354/356 of query aligns to 12:92/98 of 1ewyC
1czpA Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a (see paper)
38% identity, 23% coverage: 274:354/356 of query aligns to 12:92/98 of 1czpA
P0A3C7 Ferredoxin-1; Ferredoxin I from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
38% identity, 23% coverage: 274:354/356 of query aligns to 13:93/99 of P0A3C7
Sites not aligning to the query:
1gaqB Crystal structure of the complex between ferredoxin and ferredoxin- NADP+ reductase (see paper)
43% identity, 20% coverage: 285:354/356 of query aligns to 21:90/98 of 1gaqB
6yacN Plant psi-ferredoxin supercomplex (see paper)
42% identity, 24% coverage: 271:354/356 of query aligns to 8:90/97 of 6yacN
1awdA Ferredoxin [2fe-2s] oxidized form from chlorella fusca (see paper)
42% identity, 21% coverage: 284:356/356 of query aligns to 18:90/94 of 1awdA
>3610441 FitnessBrowser__Dino:3610441
MARFHPLSVTDVRKTIRDAVVVTLKPVDGGDFGFIQGQYLTFRRSFDGTELRRSYSICAG
RDDGVLQVGIKRVEGGAFSTWANDSLAPGMTLEAMAPMGSFHTPLDPHTPRNYLAFAGGS
GITPILSILKTVLAREPGSRLTLVYANRGVNTIMFREELEDLKNLHMGRLTVIHVLESDA
QEIDLFTGRVDGAKCDALFAHWIDIDSIDTAFICGPEPMMLGIAAALRAHGMTDDRIKFE
LFASGQPGRLPRKPGAAAGHDPEARATAATVTMDGAARSFAMDKDQSILDAALANALDAP
YACKAGVCSTCKCKVLEGEVEMIANHALEDYEVARGYVLSCQSYPVTDRVVVTYDH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory