SitesBLAST
Comparing 3610459 Dshi_3840 thiamine pyrophosphate protein TPP binding domain protein (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4rjiC Acetolactate synthase from bacillus subtilis bound to thdp - crystal form i (see paper)
31% identity, 98% coverage: 4:539/546 of query aligns to 1:540/555 of 4rjiC
- binding magnesium ion: D438 (= D438), D465 (= D465), T467 (≠ G467)
- binding thiamine diphosphate: P24 (= P27), E48 (= E51), P74 (= P77), S387 (≠ L387), H388 (= H388), Q411 (≠ A411), G437 (= G437), D438 (= D438), G439 (= G439), G440 (≠ D440), T467 (≠ G467), Y468 (= Y468), D469 (≠ G469), M470 (≠ L470), V471 (≠ I471), Y534 (= Y533)
4rjkF Acetolactate synthase from bacillus subtilis bound to lthdp - crystal form ii (see paper)
31% identity, 98% coverage: 7:539/546 of query aligns to 3:539/552 of 4rjkF
- binding magnesium ion: D437 (= D438), D464 (= D465), T466 (≠ G467)
- binding pyruvic acid: A25 (≠ E29), K26 (≠ E30)
- binding thiamine diphosphate: P23 (= P27), E47 (= E51), P73 (= P77), G385 (= G386), S386 (≠ L387), H387 (= H388), Q410 (≠ A411), L412 (≠ M413), G436 (= G437), D437 (= D438), G438 (= G439), G439 (≠ D440), T466 (≠ G467), Y467 (= Y468), D468 (≠ G469), M469 (≠ L470), V470 (≠ I471), Y533 (= Y533)
4rjkG Acetolactate synthase from bacillus subtilis bound to lthdp - crystal form ii (see paper)
31% identity, 98% coverage: 7:539/546 of query aligns to 3:539/553 of 4rjkG
- binding magnesium ion: D437 (= D438), D464 (= D465), T466 (≠ G467)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-carboxy-1-hydroxyethyl)-5-(2-{[hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: E47 (= E51), Q110 (= Q114)
- binding thiamine diphosphate: I384 (≠ V385), G385 (= G386), S386 (≠ L387), H387 (= H388), Q410 (≠ A411), L412 (≠ M413), G436 (= G437), D437 (= D438), G438 (= G439), G439 (≠ D440), T466 (≠ G467), Y467 (= Y468), D468 (≠ G469), M469 (≠ L470), V470 (≠ I471), Y533 (= Y533)
1ozfA The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactors (see paper)
31% identity, 97% coverage: 7:533/546 of query aligns to 7:534/545 of 1ozfA
- active site: I26 (≠ V26), G28 (= G28), A29 (≠ E29), K30 (≠ E30), I31 (≠ T31), E51 (= E51), T74 (= T74), H113 (= H113), Q114 (= Q114), S115 (≠ I115), Q163 (≠ E163), L253 (≠ Q254), E280 (≠ P281), M385 (≠ V385), Q411 (≠ A411), M413 (= M413), D438 (= D438), D465 (= D465), G467 (= G467), Y468 (= Y468), M470 (≠ L470), V471 (≠ I471), Q474 (≠ H474), Y534 (= Y533)
- binding magnesium ion: D438 (= D438), D465 (= D465), G467 (= G467)
- binding phosphate ion: G249 (vs. gap), R250 (vs. gap), Q257 (≠ D258), R343 (≠ Q343), R394 (= R394), L396 (≠ V396), Y397 (≠ L397)
- binding thiamine diphosphate: G386 (= G386), S387 (≠ L387), F388 (≠ H388), Q411 (≠ A411), M413 (= M413), G437 (= G437), D438 (= D438), G439 (= G439), D465 (= D465), G467 (= G467), Y468 (= Y468), N469 (≠ G469), M470 (≠ L470), V471 (≠ I471), Y534 (= Y533)
5d6rB Acetolactate synthase from klebsiella pneumoniae in complex with mechanism-based inhibitor
31% identity, 97% coverage: 7:533/546 of query aligns to 7:535/548 of 5d6rB
- active site: I26 (≠ V26), G28 (= G28), A29 (≠ E29), K30 (≠ E30), I31 (≠ T31), E51 (= E51), T74 (= T74), H113 (= H113), Q114 (= Q114), S115 (≠ I115), Q163 (≠ E163), L254 (≠ Q254), E281 (≠ P281), M386 (≠ V385), Q412 (≠ A411), M414 (= M413), D439 (= D438), D466 (= D465), G468 (= G467), Y469 (= Y468), M471 (≠ L470), V472 (≠ I471), Q475 (≠ H474), Y535 (= Y533)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(Z)-2-fluoro-1-hydroxy-2-phosphonoethenyl]-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: M386 (≠ V385), G387 (= G386), S388 (≠ L387), Q412 (≠ A411), M414 (= M413), D439 (= D438), G440 (= G439), G468 (= G467), Y469 (= Y468), N470 (≠ G469), M471 (≠ L470), Y535 (= Y533)
- binding magnesium ion: R63 (= R63), Q212 (≠ R213), D439 (= D438), D466 (= D465), G468 (= G467)
1ozgA The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate (see paper)
31% identity, 97% coverage: 7:533/546 of query aligns to 8:538/549 of 1ozgA
- active site: I27 (≠ V26), G29 (= G28), A30 (≠ E29), K31 (≠ E30), I32 (≠ T31), E52 (= E51), T75 (= T74), H114 (= H113), Q115 (= Q114), S116 (≠ I115), Q164 (≠ E163), L257 (≠ Q254), E284 (≠ P281), M389 (≠ V385), Q415 (≠ A411), M417 (= M413), D442 (= D438), D469 (= D465), G471 (= G467), Y472 (= Y468), M474 (≠ L470), V475 (≠ I471), Q478 (≠ H474), Y538 (= Y533)
- binding 2-hydroxyethyl dihydrothiachrome diphosphate: M389 (≠ V385), G390 (= G386), S391 (≠ L387), F392 (≠ H388), Q415 (≠ A411), M417 (= M413), G441 (= G437), D442 (= D438), G443 (= G439), D469 (= D465), G471 (= G467), Y472 (= Y468), N473 (≠ G469), M474 (≠ L470), V475 (≠ I471), Y538 (= Y533)
- binding magnesium ion: D442 (= D438), D469 (= D465), G471 (= G467)
- binding phosphate ion: G253 (vs. gap), R254 (vs. gap), Q261 (≠ D258), R347 (≠ Q343), R398 (= R394), Y401 (≠ L397)
5dx6A Acetolactate synthase from klebsiella pneumoniae soaked with beta- fluoropyruvate
30% identity, 97% coverage: 7:533/546 of query aligns to 8:530/541 of 5dx6A
- active site: I27 (≠ V26), G29 (= G28), A30 (≠ E29), K31 (≠ E30), I32 (≠ T31), E52 (= E51), T75 (= T74), Q159 (≠ E163), L249 (≠ Q254), E276 (≠ P281), M381 (≠ V385), Q407 (≠ A411), M409 (= M413), D434 (= D438), D461 (= D465), G463 (= G467), Y464 (= Y468), M466 (≠ L470), V467 (≠ I471), Q470 (≠ H474), Y530 (= Y533)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(1R)-2-fluoro-1-hydroxyethyl]-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: M381 (≠ V385), G382 (= G386), S383 (≠ L387), F384 (≠ H388), Q407 (≠ A411), M409 (= M413), G433 (= G437), D434 (= D438), G435 (= G439), D461 (= D465), G463 (= G467), Y464 (= Y468), N465 (≠ G469), Y530 (= Y533)
- binding magnesium ion: S119 (≠ A123), T122 (= T126), D434 (= D438), D461 (= D465), G463 (= G467)
5dx6B Acetolactate synthase from klebsiella pneumoniae soaked with beta- fluoropyruvate
30% identity, 97% coverage: 7:533/546 of query aligns to 19:541/557 of 5dx6B
- active site: I38 (≠ V26), G40 (= G28), A41 (≠ E29), K42 (≠ E30), I43 (≠ T31), E63 (= E51), T86 (= T74), H125 (= H113), Q126 (= Q114), S127 (≠ I115), Q175 (≠ E163), L268 (≠ Q254), E295 (≠ P281), M392 (≠ V385), Q418 (≠ A411), M420 (= M413), D445 (= D438), D472 (= D465), G474 (= G467), Y475 (= Y468), M477 (≠ L470), V478 (≠ I471), Q481 (≠ H474), Y541 (= Y533)
- binding 3-fluoro-2-oxopropanoic acid: G264 (vs. gap), R265 (vs. gap), Q272 (≠ D258), A400 (= A393), R401 (= R394), Y404 (≠ L397)
- binding magnesium ion: S135 (≠ A123), T138 (= T126), D445 (= D438), D472 (= D465), G474 (= G467)
- binding thiamine diphosphate: G393 (= G386), S394 (≠ L387), F395 (≠ H388), Q418 (≠ A411), M420 (= M413), G444 (= G437), D445 (= D438), G446 (= G439), D472 (= D465), G474 (= G467), Y475 (= Y468), N476 (≠ G469), M477 (≠ L470), V478 (≠ I471), Y541 (= Y533)
5wdgA Acetolactate synthase from klebsiella pneumoniae in complex with a reaction intermediate
30% identity, 97% coverage: 7:533/546 of query aligns to 8:527/538 of 5wdgA
- active site: I27 (≠ V26), G29 (= G28), A30 (≠ E29), K31 (≠ E30), I32 (≠ T31), E52 (= E51), T75 (= T74), Q157 (≠ E163), L246 (≠ Q254), E273 (≠ P281), M378 (≠ V385), Q404 (≠ A411), M406 (= M413), D431 (= D438), D458 (= D465), G460 (= G467), Y461 (= Y468), M463 (≠ L470), V464 (≠ I471), Q467 (≠ H474), Y527 (= Y533)
- binding (2S,3S)-2,3-dihydroxy-3-[(7S,8R,9aS)-8-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-2,7-dimethyl-5,7,8,10-tetrahydro-9aH-pyrimido[4,5-d][1,3]thiazolo[3,2-a]pyrimidin-9a-yl]-2-methylbutanoic acid: M378 (≠ V385), S380 (≠ L387), F381 (≠ H388), Q404 (≠ A411), M406 (= M413), G430 (= G437), D431 (= D438), G432 (= G439), G433 (≠ D440), D458 (= D465), G460 (= G467), Y461 (= Y468), N462 (≠ G469), M463 (≠ L470), V464 (≠ I471), Y527 (= Y533)
- binding magnesium ion: R64 (= R63), S117 (≠ A123), T120 (= T126), Q204 (≠ R213), D431 (= D438), D458 (= D465), G460 (= G467)
- binding pyruvic acid: G94 (≠ F93), R147 (≠ K153)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
30% identity, 96% coverage: 5:529/546 of query aligns to 11:553/582 of 3ea4A
- active site: Y32 (≠ V26), G34 (= G28), G35 (≠ E29), A36 (≠ E30), S37 (≠ T31), E58 (= E51), T81 (= T74), F120 (≠ H113), Q121 (= Q114), E122 (≠ I115), K170 (≠ E163), M265 (≠ Q254), V292 (= V278), V399 (= V385), G425 (≠ A411), M427 (= M413), D452 (= D438), N479 (vs. gap), H481 (vs. gap), L482 (vs. gap), M484 (vs. gap), V485 (= V460), W488 (= W463)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D276), R291 (≠ P277), W488 (= W463)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (≠ K153), G221 (= G208), G222 (≠ A209), G223 (= G210), T245 (≠ S234), L246 (≠ F235), M247 (= M236), L263 (≠ V252), G264 (= G253), M265 (≠ Q254), H266 (≠ P255), G285 (= G274), R287 (vs. gap), D289 (vs. gap), R291 (≠ P277), D309 (≠ H295), I310 (≠ L296), G327 (≠ A315), D328 (≠ G316), V329 (≠ L317), M404 (≠ L390), G422 (≠ N408)
- binding magnesium ion: D452 (= D438), N479 (vs. gap), H481 (vs. gap)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V385), G400 (= G386), Q401 (≠ L387), H402 (= H388), M427 (= M413), G451 (= G437), D452 (= D438), G453 (= G439), S454 (≠ D440), N479 (vs. gap), H481 (vs. gap), L482 (vs. gap), G483 (vs. gap), M484 (vs. gap), V485 (= V460)
Sites not aligning to the query:
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
30% identity, 96% coverage: 5:529/546 of query aligns to 11:553/582 of 3e9yA
- active site: Y32 (≠ V26), G34 (= G28), G35 (≠ E29), A36 (≠ E30), S37 (≠ T31), E58 (= E51), T81 (= T74), F120 (≠ H113), Q121 (= Q114), E122 (≠ I115), K170 (≠ E163), M265 (≠ Q254), V292 (= V278), V399 (= V385), G425 (≠ A411), M427 (= M413), D452 (= D438), N479 (vs. gap), H481 (vs. gap), L482 (vs. gap), M484 (vs. gap), V485 (= V460), W488 (= W463)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D276), R291 (≠ P277), W488 (= W463)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (≠ K153), G221 (= G208), G222 (≠ A209), G223 (= G210), T245 (≠ S234), L246 (≠ F235), M247 (= M236), L263 (≠ V252), G285 (= G274), R287 (vs. gap), D289 (vs. gap), R291 (≠ P277), D309 (≠ H295), I310 (≠ L296), G327 (≠ A315), D328 (≠ G316), V329 (≠ L317), M404 (≠ L390), G422 (≠ N408)
- binding magnesium ion: D452 (= D438), N479 (vs. gap), H481 (vs. gap)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V385), G400 (= G386), Q401 (≠ L387), H402 (= H388), M427 (= M413), G451 (= G437), G453 (= G439), S454 (≠ D440), N479 (vs. gap), H481 (vs. gap), L482 (vs. gap), G483 (vs. gap), M484 (vs. gap), V485 (= V460)
Sites not aligning to the query:
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
30% identity, 96% coverage: 5:529/546 of query aligns to 12:554/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ Q254), R292 (≠ P277), W489 (= W463)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V385), G401 (= G386), Q402 (≠ L387), H403 (= H388), G426 (≠ A411), M428 (= M413), G452 (= G437), D453 (= D438), G454 (= G439), S455 (≠ D440), L483 (vs. gap), G484 (vs. gap), M485 (vs. gap), V486 (= V460)
- binding flavin-adenine dinucleotide: R161 (≠ K153), G222 (= G208), G223 (≠ A209), G224 (= G210), T246 (≠ S234), L247 (≠ F235), M248 (= M236), M263 (≠ T251), L264 (≠ V252), M266 (≠ Q254), H267 (≠ P255), G286 (= G274), R288 (vs. gap), V293 (= V278), D310 (≠ H295), I311 (≠ L296), D329 (≠ G316), V330 (≠ L317), M405 (≠ L390), G423 (≠ N408)
- binding magnesium ion: A37 (≠ E30), T82 (= T74), S83 (≠ L75), Q122 (= Q114), Y381 (≠ D366), D453 (= D438), M458 (= M443), Q461 (= Q446), N480 (vs. gap), H482 (vs. gap), K533 (≠ L508)
Sites not aligning to the query:
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
30% identity, 96% coverage: 5:529/546 of query aligns to 12:554/585 of 5k2oA
- active site: Y33 (≠ V26), G35 (= G28), G36 (≠ E29), A37 (≠ E30), S38 (≠ T31), E59 (= E51), T82 (= T74), F121 (≠ H113), Q122 (= Q114), E123 (≠ I115), K171 (≠ E163), M266 (≠ Q254), V293 (= V278), V400 (= V385), G426 (≠ A411), M428 (= M413), D453 (= D438), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), M485 (vs. gap), V486 (= V460), W489 (= W463)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ Q254), R292 (≠ P277), W489 (= W463)
- binding flavin-adenine dinucleotide: R161 (≠ K153), G222 (= G208), G223 (≠ A209), G224 (= G210), T246 (≠ S234), L247 (≠ F235), M248 (= M236), L264 (≠ V252), G286 (= G274), R288 (vs. gap), D290 (vs. gap), V293 (= V278), D310 (≠ H295), I311 (≠ L296), D329 (≠ G316), V330 (≠ L317), Q404 (≠ K389), M405 (≠ L390), G423 (≠ N408)
- binding magnesium ion: D453 (= D438), N480 (vs. gap), H482 (vs. gap)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V385), G401 (= G386), Q402 (≠ L387), H403 (= H388), M428 (= M413), D453 (= D438), G454 (= G439), S455 (≠ D440), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), G484 (vs. gap), M485 (vs. gap), V486 (= V460)
Sites not aligning to the query:
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
30% identity, 96% coverage: 5:529/546 of query aligns to 97:639/670 of P17597
- A122 (≠ E30) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ T32) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E51) binding
- S186 (≠ F93) binding
- P197 (≠ G104) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ G106) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q114) binding
- K220 (= K127) binding
- R246 (≠ K153) binding ; binding
- K256 (≠ E163) binding
- G308 (≠ A209) binding
- TL 331:332 (≠ SF 234:235) binding
- C340 (≠ P243) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ VGQP 252:255) binding
- GVRFD 371:375 (≠ GF--- 274:275) binding
- DR 376:377 (≠ DP 276:277) binding
- DI 395:396 (≠ HL 295:296) binding
- DV 414:415 (≠ GL 316:317) binding
- QH 487:488 (≠ LH 387:388) binding
- GG 508:509 (≠ NG 408:409) binding
- GAM 511:513 (≠ AGM 411:413) binding
- D538 (= D438) binding
- DGS 538:540 (≠ DGD 438:440) binding
- N565 (vs. gap) binding
- NQHLGM 565:570 (vs. gap) binding
- H567 (vs. gap) binding
- W574 (= W463) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
Sites not aligning to the query:
- 653 binding ; S→A: No effect on catalytic activity or sensitivity to herbicides.; S→F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; S→N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; S→T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
30% identity, 96% coverage: 5:529/546 of query aligns to 12:554/583 of 5k3sA
- active site: Y33 (≠ V26), G35 (= G28), G36 (≠ E29), A37 (≠ E30), S38 (≠ T31), E59 (= E51), T82 (= T74), F121 (≠ H113), Q122 (= Q114), E123 (≠ I115), K171 (≠ E163), M266 (≠ Q254), V293 (= V278), V400 (= V385), G426 (≠ A411), M428 (= M413), D453 (= D438), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), M485 (vs. gap), V486 (= V460), W489 (= W463)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (≠ P277), M485 (vs. gap), W489 (= W463)
- binding flavin-adenine dinucleotide: R161 (≠ K153), G222 (= G208), G223 (≠ A209), G224 (= G210), T246 (≠ S234), L247 (≠ F235), M248 (= M236), L264 (≠ V252), M266 (≠ Q254), G286 (= G274), R288 (vs. gap), D290 (vs. gap), V293 (= V278), D310 (≠ H295), I311 (≠ L296), D329 (≠ G316), V330 (≠ L317), M405 (≠ L390), G423 (≠ N408)
- binding magnesium ion: D453 (= D438), N480 (vs. gap), H482 (vs. gap)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V385), G401 (= G386), Q402 (≠ L387), H403 (= H388), G426 (≠ A411), M428 (= M413), D453 (= D438), G454 (= G439), S455 (≠ D440), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), G484 (vs. gap), M485 (vs. gap), V486 (= V460)
Sites not aligning to the query:
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
30% identity, 96% coverage: 5:529/546 of query aligns to 12:554/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V385), G401 (= G386), Q402 (≠ L387), H403 (= H388), G426 (≠ A411), M428 (= M413), G452 (= G437), D453 (= D438), G454 (= G439), S455 (≠ D440), M458 (= M443), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), G484 (vs. gap), M485 (vs. gap), V486 (= V460)
- binding flavin-adenine dinucleotide: R161 (≠ K153), G222 (= G208), G223 (≠ A209), G224 (= G210), T246 (≠ S234), L247 (≠ F235), M248 (= M236), L264 (≠ V252), M266 (≠ Q254), H267 (≠ P255), G286 (= G274), V287 (≠ F275), R288 (vs. gap), D290 (vs. gap), R292 (≠ P277), V293 (= V278), D310 (≠ H295), I311 (≠ L296), D329 (≠ G316), V330 (≠ L317), M405 (≠ L390), G423 (≠ N408)
- binding magnesium ion: F370 (≠ Y354), D453 (= D438), M458 (= M443), Q461 (= Q446), N480 (vs. gap), H482 (vs. gap), K533 (≠ L508)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ Q254), R292 (≠ P277), M485 (vs. gap), W489 (= W463)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
30% identity, 96% coverage: 5:529/546 of query aligns to 12:554/582 of 5wj1A
- active site: Y33 (≠ V26), G35 (= G28), G36 (≠ E29), A37 (≠ E30), S38 (≠ T31), E59 (= E51), T82 (= T74), F121 (≠ H113), Q122 (= Q114), E123 (≠ I115), K171 (≠ E163), M266 (≠ Q254), V293 (= V278), V400 (= V385), G426 (≠ A411), M428 (= M413), D453 (= D438), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), M485 (vs. gap), V486 (= V460), W489 (= W463)
- binding flavin-adenine dinucleotide: R161 (≠ K153), G222 (= G208), G223 (≠ A209), G224 (= G210), T246 (≠ S234), L247 (≠ F235), M248 (= M236), M263 (≠ T251), L264 (≠ V252), G286 (= G274), R288 (vs. gap), V293 (= V278), D310 (≠ H295), I311 (≠ L296), D329 (≠ G316), V330 (≠ L317), M405 (≠ L390), G423 (≠ N408), G424 (= G409)
- binding magnesium ion: D453 (= D438), N480 (vs. gap), H482 (vs. gap)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ Q254), D291 (= D276), R292 (≠ P277), M485 (vs. gap), W489 (= W463)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V385), G401 (= G386), Q402 (≠ L387), H403 (= H388), M428 (= M413), D453 (= D438), G454 (= G439), S455 (≠ D440), M458 (= M443), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), G484 (vs. gap), M485 (vs. gap), V486 (= V460)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
30% identity, 96% coverage: 5:529/546 of query aligns to 12:554/582 of 5k6tA
- active site: Y33 (≠ V26), G35 (= G28), G36 (≠ E29), A37 (≠ E30), S38 (≠ T31), E59 (= E51), T82 (= T74), F121 (≠ H113), Q122 (= Q114), E123 (≠ I115), K171 (≠ E163), M266 (≠ Q254), V293 (= V278), V400 (= V385), G426 (≠ A411), M428 (= M413), D453 (= D438), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), M485 (vs. gap), V486 (= V460), W489 (= W463)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ P255), R292 (≠ P277), M485 (vs. gap), W489 (= W463)
- binding flavin-adenine dinucleotide: R161 (≠ K153), G222 (= G208), G223 (≠ A209), G224 (= G210), T246 (≠ S234), L247 (≠ F235), M248 (= M236), L264 (≠ V252), G286 (= G274), R288 (vs. gap), D290 (vs. gap), R292 (≠ P277), V293 (= V278), D310 (≠ H295), I311 (≠ L296), D329 (≠ G316), V330 (≠ L317), Q404 (≠ K389), M405 (≠ L390), G423 (≠ N408)
- binding magnesium ion: D453 (= D438), N480 (vs. gap), H482 (vs. gap)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V385), G401 (= G386), Q402 (≠ L387), H403 (= H388), G426 (≠ A411), M428 (= M413), G452 (= G437), G454 (= G439), S455 (≠ D440), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), G484 (vs. gap)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
30% identity, 96% coverage: 5:529/546 of query aligns to 12:554/582 of 5k6rA
- active site: Y33 (≠ V26), G35 (= G28), G36 (≠ E29), A37 (≠ E30), S38 (≠ T31), E59 (= E51), T82 (= T74), F121 (≠ H113), Q122 (= Q114), E123 (≠ I115), K171 (≠ E163), M266 (≠ Q254), V293 (= V278), V400 (= V385), G426 (≠ A411), M428 (= M413), D453 (= D438), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), M485 (vs. gap), V486 (= V460), W489 (= W463)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ P277), W489 (= W463)
- binding flavin-adenine dinucleotide: R161 (≠ K153), G222 (= G208), G223 (≠ A209), G224 (= G210), T246 (≠ S234), L247 (≠ F235), M248 (= M236), L264 (≠ V252), M266 (≠ Q254), G286 (= G274), R288 (vs. gap), R292 (≠ P277), V293 (= V278), D310 (≠ H295), I311 (≠ L296), G328 (≠ A315), D329 (≠ G316), V330 (≠ L317), M405 (≠ L390), G423 (≠ N408)
- binding magnesium ion: D453 (= D438), N480 (vs. gap), H482 (vs. gap)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V385), G401 (= G386), Q402 (≠ L387), H403 (= H388), G426 (≠ A411), M428 (= M413), D453 (= D438), G454 (= G439), S455 (≠ D440), M458 (= M443), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), G484 (vs. gap), M485 (vs. gap), V486 (= V460)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
30% identity, 96% coverage: 5:529/546 of query aligns to 12:554/582 of 1z8nA
- active site: Y33 (≠ V26), G35 (= G28), G36 (≠ E29), A37 (≠ E30), S38 (≠ T31), E59 (= E51), T82 (= T74), F121 (≠ H113), Q122 (= Q114), E123 (≠ I115), K171 (≠ E163), M266 (≠ Q254), V293 (= V278), V400 (= V385), G426 (≠ A411), M428 (= M413), D453 (= D438), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), M485 (vs. gap), V486 (= V460), W489 (= W463)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K127), R161 (≠ K153), Y191 (≠ V177), R194 (≠ V180), D291 (= D276), R292 (≠ P277), D312 (≠ G297), W489 (= W463)
- binding flavin-adenine dinucleotide: R161 (≠ K153), G222 (= G208), G224 (= G210), T246 (≠ S234), L247 (≠ F235), M248 (= M236), L264 (≠ V252), G265 (= G253), M266 (≠ Q254), H267 (≠ P255), G286 (= G274), V287 (≠ F275), R288 (vs. gap), D290 (vs. gap), R292 (≠ P277), V293 (= V278), D310 (≠ H295), I311 (≠ L296), D329 (≠ G316), V330 (≠ L317), M405 (≠ L390), G423 (≠ N408), G424 (= G409)
- binding magnesium ion: D453 (= D438), N480 (vs. gap)
- binding thiamine diphosphate: V400 (= V385), G401 (= G386), Q402 (≠ L387), H403 (= H388), G426 (≠ A411), M428 (= M413), G452 (= G437), G454 (= G439), S455 (≠ D440), N480 (vs. gap), H482 (vs. gap), L483 (vs. gap), G484 (vs. gap), M485 (vs. gap), V486 (= V460)
Sites not aligning to the query:
Query Sequence
>3610459 Dshi_3840 thiamine pyrophosphate protein TPP binding domain protein (RefSeq)
MAGRRSGAQALVESLFSAGVDTVYGVPGEETTALMAALHDSEMAFVLCRHEQAAAFMAGV
HGRLTGRPAACLATLGPGATNLVTGVADATLDFVPMIAITGQGGCGRLGRESHQIIDLEA
LFAPVTKQSRTLLEADAVPGAVAEAVRLARAEKPGAVHLCLPEDVADAQTALRDVPVPQV
LPSPPAPEAIAQALTLLTRAERPILLAGAGVIRAGATAELRAFAEATGIAVVTSFMAGGV
LPPEHELTLFTVGQPEGDYVDLSFEAADLIVSVGFDPVEYPAADLSRDGAIPVLHLGAGP
APADAGWHVAGQVVAGLPETLAALAEALEARRWDMPPAFAGVQAGMRKAFARAYSTSSEG
PVAPQDICAEITRQLRAEDTVLSGVGLHKLWIARHVLPRRPGQVIIPNGLAGMGLALPGA
VAAARLQQAGRVLAICGDGDVMMNVQDMETAARLGLDLTVMVWEDGGYGLIDAHQQKAGD
DSTFGFGTPDWGRLARAFGWSHAPVAGLSELGEILRAGHDSAGPTLVSVPVDYAAGGGLP
GVRPAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory