SitesBLAST
Comparing 3610476 FitnessBrowser__Dino:3610476 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
43% identity, 50% coverage: 288:602/630 of query aligns to 24:329/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G295), G34 (= G298), T35 (≠ S299), I36 (= I300), D56 (≠ E320), H57 (≠ L321), S82 (= S350), I83 (≠ V351), A104 (= A372), A105 (= A373), A106 (= A374), K108 (= K376), N123 (= N391), I146 (= I414), K162 (= K430), F184 (= F454), G185 (= G455), N186 (= N456), V187 (= V457), S190 (= S460), S191 (= S461)
- binding uridine-5'-diphosphate: K150 (= K418), N186 (= N456), S193 (= S463), V194 (= V464), T209 (= T479), L210 (≠ V480), T211 (= T481), I215 (≠ V485), R217 (= R487), E279 (= E558)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
43% identity, 50% coverage: 288:602/630 of query aligns to 24:329/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G295), G34 (= G298), T35 (≠ S299), I36 (= I300), D56 (≠ E320), H57 (≠ L321), S82 (= S350), I83 (≠ V351), A104 (= A372), A105 (= A373), A106 (= A374), K108 (= K376), N123 (= N391), I146 (= I414), K162 (= K430), F184 (= F454), G185 (= G455), N186 (= N456), V187 (= V457), S190 (= S460), S191 (= S461)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K376), H109 (= H377), T148 (≠ S416), G185 (= G455), N186 (= N456), S193 (= S463), V194 (= V464), T209 (= T479), L210 (≠ V480), T211 (= T481), I215 (≠ V485), R217 (= R487), R276 (= R555), E279 (= E558)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
33% identity, 51% coverage: 286:606/630 of query aligns to 3:314/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G295), T14 (≠ G297), G15 (= G298), T16 (≠ S299), I17 (= I300), S37 (≠ E320), R38 (≠ L321), S39 (≠ N322), D63 (≠ S350), I64 (≠ V351), V83 (≠ A372), A84 (= A373), K87 (= K376), T125 (≠ I414), S127 (= S416), Y137 (≠ M426), K141 (= K430), F167 (= F454), V170 (= V457), S173 (= S460), R174 (≠ S461)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K376), H88 (= H377), S127 (= S416), N128 (≠ D417), Y137 (≠ M426), N169 (= N456), S176 (= S463), V177 (= V464), L180 (= L467), T192 (= T479), T194 (= T481), M198 (≠ V485), R200 (= R487), L234 (≠ I522), E265 (= E558)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
33% identity, 44% coverage: 286:564/630 of query aligns to 2:264/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G295), T13 (≠ G297), G14 (= G298), S15 (= S299), F16 (≠ I300), S36 (≠ E320), R37 (≠ L321), D38 (≠ N322), K41 (≠ A325), D60 (≠ S350), V61 (= V351), A80 (= A372), A81 (= A373), A82 (= A374), K84 (= K376), T99 (≠ N391), L122 (≠ I414), K138 (= K430), Y164 (≠ F454)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
32% identity, 44% coverage: 286:564/630 of query aligns to 11:272/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K376), Q94 (≠ H377), N175 (= N456), S179 (= S460), R180 (≠ S461), S182 (= S463), V183 (= V464), L186 (= L467), T198 (= T479), I199 (≠ V480), T200 (= T481), M204 (≠ V485), R206 (= R487), V240 (= V523), R263 (= R555), E266 (= E558)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
32% identity, 44% coverage: 286:564/630 of query aligns to 11:272/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G295), T22 (≠ G297), G23 (= G298), S24 (= S299), F25 (≠ I300), S45 (≠ E320), R46 (≠ L321), D47 (≠ N322), K50 (≠ A325), D69 (≠ S350), V70 (= V351), A89 (= A372), A90 (= A373), A91 (= A374), K93 (= K376), L131 (≠ I414), T133 (≠ S416), K147 (= K430), Y173 (≠ F454)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ H377), V95 (= V378), K135 (= K418), N175 (= N456), S182 (= S463), V183 (= V464), L186 (= L467), T198 (= T479), T200 (= T481), M204 (≠ V485), V240 (= V523), R263 (= R555), E266 (= E558)
Sites not aligning to the query:
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: 278, 313, 314, 315, 316, 320
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
32% identity, 44% coverage: 286:564/630 of query aligns to 3:264/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G295), T14 (≠ G297), G15 (= G298), F17 (≠ I300), S37 (≠ E320), R38 (≠ L321), D39 (≠ N322), K42 (≠ A325), D61 (≠ S350), V62 (= V351), R63 (≠ T352), A81 (= A372), A82 (= A373), A83 (= A374), K85 (= K376), S124 (= S415), T125 (≠ S416), K139 (= K430), Y165 (≠ F454), G166 (= G455)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
30% identity, 46% coverage: 288:579/630 of query aligns to 4:277/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G295), T13 (≠ G297), G14 (= G298), S15 (= S299), F16 (≠ I300), S37 (≠ E320), R38 (≠ L321), D39 (≠ N322), K42 (≠ A325), D61 (≠ S350), V62 (= V351), A81 (= A372), A82 (= A373), A83 (= A374), K85 (= K376), T100 (≠ N391), L123 (≠ I414), S124 (= S415), K139 (= K430), Y165 (≠ F454), G166 (= G455), V168 (= V457), S171 (= S460), R172 (≠ S461)
- binding uridine-5'-diphosphate: K127 (= K418), N167 (= N456), V175 (= V464), P191 (≠ T479), I192 (≠ V480), T193 (= T481), M197 (≠ V485), R199 (= R487), M233 (≠ I522), R252 (= R555)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
30% identity, 46% coverage: 288:579/630 of query aligns to 6:279/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K376), S176 (= S463), V177 (= V464), T195 (= T481), M199 (≠ V485), R201 (= R487), M235 (≠ I522), R254 (= R555), E257 (= E558)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G295), T15 (≠ G297), G16 (= G298), S17 (= S299), F18 (≠ I300), S39 (≠ E320), R40 (≠ L321), D41 (≠ N322), K44 (≠ A325), D63 (≠ S350), V64 (= V351), A83 (= A372), A84 (= A373), A85 (= A374), K87 (= K376), L125 (≠ I414), S126 (= S415), Y137 (≠ M426), K141 (= K430), Y167 (≠ F454), G168 (= G455), V170 (= V457)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
30% identity, 46% coverage: 288:579/630 of query aligns to 6:279/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G295), T15 (≠ G297), G16 (= G298), S17 (= S299), F18 (≠ I300), R40 (≠ L321), D41 (≠ N322), K44 (≠ A325), D63 (≠ S350), V64 (= V351), A83 (= A372), A84 (= A373), A85 (= A374), K87 (= K376), L125 (≠ I414), S126 (= S415), K141 (= K430), Y167 (≠ F454), G168 (= G455), V170 (= V457), R174 (≠ S461)
- binding uridine-5'-diphosphate-glucose: K87 (= K376), T127 (≠ S416), K129 (= K418), Y137 (≠ M426), N169 (= N456), S176 (= S463), V177 (= V464), P193 (≠ T479), T195 (= T481), M199 (≠ V485), R201 (= R487), M235 (≠ I522), R254 (= R555), E257 (= E558)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
30% identity, 46% coverage: 288:579/630 of query aligns to 6:279/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G295), T15 (≠ G297), G16 (= G298), S17 (= S299), F18 (≠ I300), R40 (≠ L321), D41 (≠ N322), K44 (≠ A325), D63 (≠ S350), V64 (= V351), A84 (= A373), A85 (= A374), K87 (= K376), S126 (= S415), Y137 (≠ M426), K141 (= K430), Y167 (≠ F454), G168 (= G455), V170 (= V457), S173 (= S460), R174 (≠ S461)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K376), D128 (= D417), K129 (= K418), N169 (= N456), G175 (= G462), S176 (= S463), V177 (= V464), P193 (≠ T479), I194 (≠ V480), M199 (≠ V485), R201 (= R487), M235 (≠ I522), R254 (= R555), E257 (= E558)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
30% identity, 46% coverage: 288:579/630 of query aligns to 6:279/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G295), T15 (≠ G297), G16 (= G298), S17 (= S299), F18 (≠ I300), S39 (≠ E320), R40 (≠ L321), D41 (≠ N322), K44 (≠ A325), D63 (≠ S350), V64 (= V351), A83 (= A372), A84 (= A373), A85 (= A374), K87 (= K376), T102 (≠ N391), L125 (≠ I414), S126 (= S415), T127 (≠ S416), Y137 (≠ M426), K141 (= K430), Y167 (≠ F454), G168 (= G455), V170 (= V457), S173 (= S460), R174 (≠ S461)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K376), T127 (≠ S416), D128 (= D417), K129 (= K418), Y137 (≠ M426), N169 (= N456), S176 (= S463), V177 (= V464), P193 (≠ T479), T195 (= T481), M199 (≠ V485), R201 (= R487), M235 (≠ I522), R254 (= R555), E257 (= E558)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
30% identity, 46% coverage: 288:579/630 of query aligns to 10:283/333 of O25511
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
26% identity, 36% coverage: 286:513/630 of query aligns to 1:198/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G295), T12 (≠ G297), G13 (= G298), S14 (= S299), F15 (≠ I300), S35 (≠ E320), R36 (≠ L321), D37 (≠ N322), K40 (≠ A325), D59 (≠ S350), V60 (= V351), A80 (= A373), A81 (= A374), K83 (= K376), L121 (≠ I414), T123 (≠ S416), K137 (= K430), Y163 (≠ F454), G164 (= G455)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
27% identity, 37% coverage: 292:526/630 of query aligns to 34:266/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G298), S41 (= S299), I42 (= I300), D62 (≠ E320), I63 (≠ L321), D92 (vs. gap), I93 (vs. gap), L114 (≠ A372), S115 (≠ A373), A116 (= A374), K118 (= K376), V158 (≠ I414), D161 (= D417), K174 (= K430), V198 (= V457), S201 (= S460)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
24% identity, 44% coverage: 288:564/630 of query aligns to 5:245/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G295), S14 (≠ G297), G15 (= G298), S16 (= S299), L17 (≠ I300), R36 (≠ L321), D37 (≠ N322), D59 (≠ S350), I60 (≠ V351), A81 (= A372), A82 (= A373), A83 (= A374), K85 (= K376), V128 (≠ I414), Y140 (≠ M426), K144 (= K430), Y168 (≠ F454), G169 (= G455), V171 (= V457)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
27% identity, 35% coverage: 292:512/630 of query aligns to 32:236/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G298), S39 (= S299), I40 (= I300), D60 (≠ E320), I61 (≠ L321), L89 (= L348), D90 (vs. gap), I91 (vs. gap), L112 (≠ A372), S113 (≠ A373), A114 (= A374), K116 (= K376), D159 (= D417), K172 (= K430), N195 (= N456), V196 (= V457), S199 (= S460)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
24% identity, 39% coverage: 291:535/630 of query aligns to 3:257/309 of 4zrnA
- active site: T117 (≠ S416), G119 (≠ K418), A120 (= A419), Y143 (≠ M426), K147 (= K430), Y181 (vs. gap), G185 (≠ S463)
- binding nicotinamide-adenine-dinucleotide: G7 (= G295), G10 (= G298), F11 (≠ S299), I12 (= I300), D31 (≠ Y319), N32 (≠ E320), S34 (≠ N322), S35 (≠ E323), G36 (≠ L324), S51 (= S350), I52 (≠ V351), L73 (≠ A372), A74 (= A373), A75 (= A374), T92 (≠ N391), S115 (≠ I414), S116 (= S415), Y143 (≠ M426), K147 (= K430), Y170 (≠ F454), V173 (= V457)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S416), G119 (≠ K418), A120 (= A419), Y143 (≠ M426), N172 (= N456), G185 (≠ S463), V186 (= V464), H201 (≠ T479), F203 (vs. gap), Y208 (≠ V485), R210 (= R487), V244 (≠ I522)
Sites not aligning to the query:
6vloA X-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus (see paper)
22% identity, 41% coverage: 289:544/630 of query aligns to 4:274/319 of 6vloA
- active site: T126 (≠ S416), D127 (= D417), E128 (≠ K418), Y151 (≠ M426), K155 (= K430)
- binding nicotinamide-adenine-dinucleotide: G10 (= G295), G13 (= G298), F14 (≠ S299), I15 (= I300), D36 (≠ N328), I37 (≠ V329), A42 (≠ R334), D59 (≠ S350), I60 (≠ V351), F81 (≠ A372), A82 (= A373), A83 (= A374), S85 (≠ K376), M124 (≠ I414), T126 (≠ S416), K155 (= K430)
- binding thymidine-5'-diphosphate: N180 (= N456), K190 (≠ S463), L191 (≠ V464), K194 (≠ L467), H206 (≠ T479), Q208 (≠ T481), R215 (vs. gap), V250 (≠ I522)
Sites not aligning to the query:
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 42% coverage: 285:550/630 of query aligns to 5:282/667 of Q9LPG6
- G18 (= G298) mutation to A: Abolishes dehydratase activity.
- K36 (vs. gap) mutation to A: Reduces dehydratase activity.
- D96 (≠ P379) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K430) mutation to A: Abolishes dehydratase activity.
- G193 (= G459) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
Query Sequence
>3610476 FitnessBrowser__Dino:3610476
MNGLGCSVLNFVKSLTLGQKAITLLVVDLVLIPLALIVTFALQPIPVSPGETIALILPIL
PYLLAASALVAFWLGIPYIRLNAYEARAVGKTAQYAAANGLIALVLSKIAGLGLTTGLYV
IFAGCFFLFSAASRVVMLQILTAIYRRDEGHTRVMIYGAGTTGTQLVSALNAHKTIYPVA
FVDDNAALHGLTVAGLPVHSPVRIRELVRDKQIDRVLLAVPSLSQPKQAQLARRLQKLGL
EVQALPSFSQLIGEEELVDKLKPVESHTFLGRQQVCTELERGCESYADRVVLISGAGGSI
GSELCRQVLACRPAKLVLYELNELALYNVDMELRSLAEVTGTELVPVLGSVTDPRQVRGV
LAEHKVQVVLHAAAYKHVPLVEANPLAGLANNVFGTQTLAREAAEYGIERFILISSDKAV
RPTNVMGASKRLAELVIQDLETRYTGTVFTMVRFGNVLGSSGSVVPLFQEQIRRGGPVTV
TDPKVTRYFMTVQEAVRLVLTAGSMARGGEVFVLDMGAPVPIVQLARQVIESAGYTVRDD
ATPDGDIEIVFTGLRPGEKMFEELTITDDHIGTRHPKLFCAREQSLSEIEIAGILRSLRQ
AVASGDPDAGRAVITRWVEGYVPGVKSVPL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory