SitesBLAST
Comparing 3610487 FitnessBrowser__Dino:3610487 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3enkA 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
56% identity, 91% coverage: 4:329/359 of query aligns to 6:331/340 of 3enkA
- active site: S127 (= S125), S128 (= S126), T130 (= T128), Y152 (= Y150), K156 (= K154)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), G14 (= G12), Y15 (= Y13), I16 (= I14), D35 (= D33), N36 (≠ D34), V38 (≠ S36), N39 (= N37), S40 (≠ A38), D62 (≠ S60), V63 (= V61), F84 (= F82), A85 (= A83), A86 (= A84), K88 (= K86), N103 (≠ T101), S126 (= S124), S128 (= S126), Y152 (= Y150), K156 (= K154), Y180 (= Y178), P183 (= P181)
- binding uridine-5'-diphosphate-glucose: T130 (= T128), N182 (= N180), N201 (= N199), N202 (= N200), L203 (= L201), R219 (≠ Q217), V220 (= V218), F221 (= F219), R234 (= R232), Y236 (= Y234), V272 (= V270), R295 (= R293), D298 (= D296)
7kn1A Crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound NAD and formylated udp- arabinopyranose
51% identity, 93% coverage: 4:336/359 of query aligns to 4:336/336 of 7kn1A
- active site: S126 (= S126), Y150 (= Y150), K154 (= K154)
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), G12 (= G12), Y13 (= Y13), I14 (= I14), D33 (= D33), S34 (≠ D34), C36 (≠ S36), N37 (= N37), D60 (≠ S60), I61 (≠ V61), F82 (= F82), A83 (= A83), A84 (= A84), K86 (= K86), S124 (= S124), S125 (= S125), S126 (= S126), Y150 (= Y150), K154 (= K154), Y178 (= Y178), P181 (= P181)
- binding UDP-4-deoxy-4-formamido-beta-L-arabinopyranose: V88 (= V88), S126 (= S126), Y150 (= Y150), N180 (= N180), S199 (≠ N199), N200 (= N200), L201 (= L201), Q217 (= Q217), V218 (= V218), F219 (= F219), R232 (= R232), Y234 (= Y234), V270 (= V270), R293 (= R293), D296 (= D296)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
50% identity, 92% coverage: 1:329/359 of query aligns to 1:336/348 of Q14376
- GYI 12:14 (= GYI 12:14) binding
- DNFHN 33:37 (≠ DDFSN 33:37) binding
- N34 (≠ D34) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (≠ SV 60:61) binding
- F88 (= F82) binding
- G90 (≠ A84) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (= K86) binding
- V94 (= V88) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ A97) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (= S126) mutation to A: Loss of activity.
- SAT 132:134 (= SAT 126:128) binding
- Y157 (= Y150) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K154) binding
- A180 (≠ F173) to V: in dbSNP:rs3204468
- L183 (= L176) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y178) binding
- YFN 185:187 (= YFN 178:180) binding
- NNL 206:208 (= NNL 199:201) binding
- NVF 224:226 (≠ QVF 217:219) binding
- R239 (= R232) binding
- K257 (≠ S250) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RPGD 293:296) binding
- C307 (≠ Y300) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ R306) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G312) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ A328) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
50% identity, 92% coverage: 1:329/359 of query aligns to 1:336/346 of 1ek6A
- active site: S132 (= S126), A133 (= A127), T134 (= T128), Y157 (= Y150), K161 (= K154)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G9), G12 (= G12), Y13 (= Y13), I14 (= I14), D33 (= D33), N34 (≠ D34), H36 (≠ S36), N37 (= N37), D66 (≠ S60), I67 (≠ V61), F88 (= F82), A89 (= A83), G90 (≠ A84), K92 (= K86), S130 (= S124), S131 (= S125), S132 (= S126), Y157 (= Y150), K161 (= K154), Y185 (= Y178), P188 (= P181)
- binding uridine-5'-diphosphate-glucose: S132 (= S126), Y157 (= Y150), F186 (= F179), N187 (= N180), N207 (= N200), L208 (= L201), N224 (≠ Q217), V225 (= V218), F226 (= F219), R239 (= R232), Y241 (= Y234), V277 (= V270), R300 (= R293), D303 (= D296)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
50% identity, 91% coverage: 3:329/359 of query aligns to 2:335/345 of 1hzjA
- active site: S131 (= S126), A132 (= A127), T133 (= T128), Y156 (= Y150), K160 (= K154)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (≠ D34), H35 (≠ S36), N36 (= N37), D65 (≠ S60), I66 (≠ V61), F87 (= F82), A88 (= A83), G89 (≠ A84), K91 (= K86), S129 (= S124), S131 (= S126), Y156 (= Y150), K160 (= K154), Y184 (= Y178), P187 (= P181)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N180), N206 (= N200), L207 (= L201), N223 (≠ Q217), V224 (= V218), F225 (= F219), R238 (= R232), Y240 (= Y234), V276 (= V270), R299 (= R293), D302 (= D296)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
50% identity, 91% coverage: 3:329/359 of query aligns to 2:335/347 of 1i3lA
- active site: S131 (= S126), A132 (= A127), T133 (= T128), Y156 (= Y150), K160 (= K154)
- binding galactose-uridine-5'-diphosphate: N186 (= N180), N206 (= N200), L207 (= L201), N223 (≠ Q217), V224 (= V218), F225 (= F219), R238 (= R232), Y240 (= Y234), V276 (= V270), R299 (= R293), D302 (= D296)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (≠ D34), H35 (≠ S36), N36 (= N37), D65 (≠ S60), I66 (≠ V61), F87 (= F82), A88 (= A83), G89 (≠ A84), K91 (= K86), S129 (= S124), S130 (= S125), S131 (= S126), Y156 (= Y150), K160 (= K154), Y184 (= Y178), P187 (= P181)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
50% identity, 91% coverage: 3:329/359 of query aligns to 2:335/347 of 1i3kA
- active site: S131 (= S126), A132 (= A127), T133 (= T128), Y156 (= Y150), K160 (= K154)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (≠ D34), H35 (≠ S36), N36 (= N37), D65 (≠ S60), I66 (≠ V61), F87 (= F82), A88 (= A83), G89 (≠ A84), K91 (= K86), S129 (= S124), S131 (= S126), Y156 (= Y150), K160 (= K154), Y184 (= Y178), P187 (= P181)
- binding uridine-5'-diphosphate-glucose: F185 (= F179), N186 (= N180), N206 (= N200), L207 (= L201), N223 (≠ Q217), V224 (= V218), F225 (= F219), R238 (= R232), Y240 (= Y234), V276 (= V270), R299 (= R293), D302 (= D296)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
49% identity, 91% coverage: 3:329/359 of query aligns to 2:334/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (≠ D34), N36 (= N37), D62 (≠ S60), L63 (≠ V61), F84 (= F82), A85 (= A83), G86 (≠ A84), K88 (= K86), N103 (≠ T101), S126 (= S124), S128 (= S126), Y152 (= Y150), K156 (= K154), Y180 (= Y178), P183 (= P181)
- binding uridine-5'-diphosphate-glucose: S128 (= S126), A129 (= A127), F181 (= F179), N182 (= N180), N202 (= N200), L203 (= L201), T219 (≠ Q217), V220 (= V218), Y221 (≠ F219), R234 (= R232), Y236 (= Y234), V275 (= V270), R298 (= R293), D301 (= D296)
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
49% identity, 91% coverage: 3:329/359 of query aligns to 2:334/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (≠ D34), N36 (= N37), D62 (≠ S60), L63 (≠ V61), F84 (= F82), A85 (= A83), G86 (≠ A84), K88 (= K86), N103 (≠ T101), S126 (= S124), S128 (= S126), Y152 (= Y150), K156 (= K154), Y180 (= Y178), P183 (= P181)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N180), N202 (= N200), L203 (= L201), T219 (≠ Q217), Y221 (≠ F219), R234 (= R232), Y236 (= Y234), V275 (= V270), R298 (= R293), D301 (= D296)
6k0iA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glc (see paper)
49% identity, 91% coverage: 4:329/359 of query aligns to 2:327/335 of 6k0iA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y150), K153 (= K154)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (≠ Y13), I12 (= I14), D31 (= D33), N32 (≠ D34), N35 (= N37), S36 (≠ A38), D58 (≠ S60), V59 (= V61), F80 (= F82), A81 (= A83), G82 (≠ A84), K84 (= K86), N99 (≠ T101), S122 (= S124), S123 (= S125), Y149 (= Y150), K153 (= K154), Y177 (= Y178), P180 (= P181)
- binding uridine-5'-diphosphate-glucose: K84 (= K86), S124 (= S126), Y149 (= Y150), F178 (= F179), N179 (= N180), A198 (≠ N199), N199 (= N200), L200 (= L201), Q216 (= Q217), V217 (= V218), Y218 (≠ F219), R231 (= R232), Y233 (= Y234), V268 (= V270), R291 (= R293), D294 (= D296)
6k0hA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glcnac (see paper)
49% identity, 91% coverage: 4:329/359 of query aligns to 2:327/335 of 6k0hA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y150), K153 (= K154)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (≠ Y13), I12 (= I14), D31 (= D33), N32 (≠ D34), G34 (≠ S36), N35 (= N37), S36 (≠ A38), D58 (≠ S60), V59 (= V61), F80 (= F82), A81 (= A83), G82 (≠ A84), K84 (= K86), N99 (≠ T101), S123 (= S125), Y149 (= Y150), K153 (= K154), Y177 (= Y178), P180 (= P181)
- binding uridine-diphosphate-n-acetylglucosamine: K84 (= K86), S124 (= S126), Y149 (= Y150), F178 (= F179), N179 (= N180), A198 (≠ N199), N199 (= N200), L200 (= L201), Q216 (= Q217), V217 (= V218), Y218 (≠ F219), R231 (= R232), Y233 (= Y234), V268 (= V270), R291 (= R293), D294 (= D296)
6k0gA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp (see paper)
49% identity, 91% coverage: 4:329/359 of query aligns to 2:327/335 of 6k0gA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y150), K153 (= K154)
- binding magnesium ion: E66 (≠ A68), H114 (≠ A116)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (≠ Y13), I12 (= I14), D31 (= D33), N32 (≠ D34), N35 (= N37), S36 (≠ A38), D58 (≠ S60), V59 (= V61), F80 (= F82), A81 (= A83), G82 (≠ A84), K84 (= K86), N99 (≠ T101), S122 (= S124), S123 (= S125), Y149 (= Y150), K153 (= K154), Y177 (= Y178), P180 (= P181)
- binding uridine-5'-diphosphate: N179 (= N180), A198 (≠ N199), N199 (= N200), L200 (= L201), Q216 (= Q217), V217 (= V218), Y218 (≠ F219), R231 (= R232), Y233 (= Y234), V268 (= V270), R291 (= R293), D294 (= D296)
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
48% identity, 92% coverage: 5:333/359 of query aligns to 3:331/338 of 1udaA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y150), K153 (= K154), M189 (≠ I190)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (≠ D34), L33 (≠ F35), C34 (≠ S36), N35 (= N37), S36 (≠ A38), D58 (≠ S60), I59 (≠ V61), F80 (= F82), A81 (= A83), G82 (≠ A84), K84 (= K86), S122 (= S124), Y149 (= Y150), K153 (= K154), Y177 (= Y178), P180 (= P181)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (= T128), N179 (= N180), N199 (= N200), L200 (= L201), A216 (≠ Q217), I217 (≠ V218), F218 (= F219), R231 (= R232), Y233 (= Y234), R292 (= R293), D295 (= D296), Y299 (= Y300)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
48% identity, 92% coverage: 5:333/359 of query aligns to 3:331/338 of 1naiA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y150), K153 (= K154), M189 (≠ I190)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (≠ D34), L33 (≠ F35), C34 (≠ S36), N35 (= N37), S36 (≠ A38), D58 (≠ S60), I59 (≠ V61), F80 (= F82), A81 (= A83), G82 (≠ A84), K84 (= K86), Y149 (= Y150), K153 (= K154), Y177 (= Y178), P180 (= P181)
- binding 1,3-propandiol: N35 (= N37), K84 (= K86), E191 (= E192), P193 (= P194)
- binding uridine-5'-diphosphate: N179 (= N180), N199 (= N200), L200 (= L201), L215 (= L216), A216 (≠ Q217), R231 (= R232), Y233 (= Y234), R292 (= R293)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
48% identity, 92% coverage: 5:333/359 of query aligns to 3:331/338 of 1lrjA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y150), K153 (= K154), M189 (≠ I190)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (≠ D34), L33 (≠ F35), C34 (≠ S36), N35 (= N37), S36 (≠ A38), D58 (≠ S60), I59 (≠ V61), F80 (= F82), A81 (= A83), G82 (≠ A84), K84 (= K86), Y149 (= Y150), K153 (= K154), Y177 (= Y178), P180 (= P181)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V88), S124 (= S126), F178 (= F179), N179 (= N180), L200 (= L201), L215 (= L216), A216 (≠ Q217), F218 (= F219), R231 (= R232), Y233 (= Y234), V269 (= V270), R292 (= R293), D295 (= D296)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
48% identity, 92% coverage: 5:333/359 of query aligns to 3:331/338 of 2udpA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y150), K153 (= K154), M189 (≠ I190)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (≠ D34), L33 (≠ F35), C34 (≠ S36), N35 (= N37), S36 (≠ A38), D58 (≠ S60), I59 (≠ V61), F80 (= F82), A81 (= A83), G82 (≠ A84), K84 (= K86), S122 (= S124), S124 (= S126), Y149 (= Y150), K153 (= K154), Y177 (= Y178)
- binding phenyl-uridine-5'-diphosphate: N179 (= N180), N199 (= N200), L200 (= L201), A216 (≠ Q217), I217 (≠ V218), F218 (= F219), R231 (= R232), Y233 (= Y234), V269 (= V270), R292 (= R293), D295 (= D296)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
48% identity, 92% coverage: 5:333/359 of query aligns to 3:331/338 of 1udcA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y150), K153 (= K154), M189 (≠ I190)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (≠ D34), C34 (≠ S36), N35 (= N37), S36 (≠ A38), D58 (≠ S60), I59 (≠ V61), F80 (= F82), A81 (= A83), G82 (≠ A84), K84 (= K86), S122 (= S124), Y149 (= Y150), K153 (= K154), Y177 (= Y178), P180 (= P181)
- binding uridine-5'-diphosphate-mannose: T126 (= T128), Y149 (= Y150), N179 (= N180), N199 (= N200), L200 (= L201), L215 (= L216), A216 (≠ Q217), I217 (≠ V218), F218 (= F219), R231 (= R232), Y233 (= Y234), V269 (= V270), R292 (= R293)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
48% identity, 92% coverage: 5:333/359 of query aligns to 3:331/338 of P09147
- YI 11:12 (= YI 13:14) binding
- DNLCNS 31:36 (≠ DDFSNA 33:38) binding
- DI 58:59 (≠ SV 60:61) binding
- FAGLK 80:84 (≠ FAARK 82:86) binding
- N99 (≠ T101) binding
- S124 (= S126) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y150) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K154) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F179) binding
- Y299 (= Y300) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
47% identity, 92% coverage: 5:333/359 of query aligns to 3:331/338 of 1kvrA
- active site: A124 (≠ S126), A125 (= A127), T126 (= T128), Y149 (= Y150), K153 (= K154), M189 (≠ I190)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (≠ D34), C34 (≠ S36), N35 (= N37), S36 (≠ A38), D58 (≠ S60), I59 (≠ V61), F80 (= F82), A81 (= A83), G82 (≠ A84), K84 (= K86), S122 (= S124), S123 (= S125), Y149 (= Y150), K153 (= K154), Y177 (= Y178), P180 (= P181)
- binding uridine-5'-diphosphate: N179 (= N180), N198 (= N199), N199 (= N200), L200 (= L201), A216 (≠ Q217), I217 (≠ V218), F218 (= F219), R231 (= R232), Y233 (= Y234), V269 (= V270), R292 (= R293), D295 (= D296)
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
47% identity, 92% coverage: 5:333/359 of query aligns to 3:331/338 of 1a9yA
- active site: A124 (≠ S126), A125 (= A127), T126 (= T128), F149 (≠ Y150), K153 (= K154)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (≠ D34), C34 (≠ S36), N35 (= N37), S36 (≠ A38), D58 (≠ S60), I59 (≠ V61), F80 (= F82), A81 (= A83), G82 (≠ A84), K84 (= K86), S122 (= S124), S123 (= S125), F149 (≠ Y150), K153 (= K154), Y177 (= Y178), P180 (= P181)
- binding uridine-5'-diphosphate-glucose: A125 (= A127), T126 (= T128), N179 (= N180), N199 (= N200), L200 (= L201), A216 (≠ Q217), I217 (≠ V218), F218 (= F219), R231 (= R232), Y233 (= Y234), R292 (= R293), D295 (= D296), Y299 (= Y300)
Query Sequence
>3610487 FitnessBrowser__Dino:3610487
MTQTILLTGGAGYIGSHTYVALKAAGFEVVILDDFSNAARDVPDRLELITGAPVRLYEGS
VLDRGLLARLFTETRIDAVVHFAARKAVGESVAMPLAYFETNCTGLVGLLQEMEAACVHR
LVFSSSATVYGIPDVTPTPETAPHRHMNPYGLTKITGELILDALATSDPKWAFGTLRYFN
PAGAHGSALIGEDPSDIPNNLMPYIAQVAMGQRPHLQVFGDDYPTPDGTGVRDYIHVEDL
AEGHVLSLKSLLETGESHLVNLGTGRGYSVLEMVAAYSAACGRALPYRIVDRRPGDVPIY
CATVERARALLGFEAKRDLAQMCASSWAWIQARAQANAAGRPTPPRQDGPYRPRGTPSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory