SitesBLAST
Comparing 3610517 FitnessBrowser__Dino:3610517 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
42% identity, 92% coverage: 7:490/526 of query aligns to 4:496/535 of 3wy2A
- active site: D97 (= D100), R197 (= R199), D199 (= D201), E268 (= E268), H329 (= H326), D330 (= D327)
- binding beta-D-glucopyranose: D59 (= D62), Y62 (= Y65), H102 (= H105), R197 (= R199), D199 (= D201), E268 (= E268), H329 (= H326), D330 (= D327), R397 (= R392)
- binding glycerol: S101 (≠ N104), D169 (≠ C171), V170 (≠ L172), P175 (≠ D177), R178 (≠ H180), Q179 (≠ E181), F203 (≠ S205), Y204 (≠ F206), H206 (≠ Y208), D240 (= D242), P244 (≠ N246), E280 (≠ K281)
- binding magnesium ion: D20 (= D23), R22 (≠ T25), V26 (≠ E29), D28 (= D31)
3wy1A Crystal structure of alpha-glucosidase (see paper)
42% identity, 92% coverage: 7:490/526 of query aligns to 4:496/535 of 3wy1A
- active site: D97 (= D100), R197 (= R199), D199 (= D201), E268 (= E268), H329 (= H326), D330 (= D327)
- binding glycerol: S101 (≠ N104), D169 (≠ C171), V170 (≠ L172), F203 (≠ S205), Y204 (≠ F206), H206 (≠ Y208)
- binding magnesium ion: D20 (= D23), D24 (≠ T27), V26 (≠ E29), D28 (= D31)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D62), Y62 (= Y65), H102 (= H105), F144 (= F146), F163 (= F165), R197 (= R199), D199 (= D201), T200 (≠ A202), G225 (≠ P227), E268 (= E268), F294 (≠ I294), H329 (= H326), D330 (= D327), R397 (= R392)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
42% identity, 92% coverage: 7:490/526 of query aligns to 4:496/535 of 3wy4A
- active site: D97 (= D100), R197 (= R199), D199 (= D201), Q268 (≠ E268), H329 (= H326), D330 (= D327)
- binding alpha-D-glucopyranose: D59 (= D62), Y62 (= Y65), H102 (= H105), I143 (≠ F145), F163 (= F165), D199 (= D201), T200 (≠ A202), G225 (≠ P227), Q268 (≠ E268), Q268 (≠ E268), F294 (≠ I294), H329 (= H326), D330 (= D327), R397 (= R392), R397 (= R392)
- binding glycerol: S101 (≠ N104), D169 (≠ C171), V170 (≠ L172), F203 (≠ S205), Y204 (≠ F206), H206 (≠ Y208), L224 (≠ I226), G225 (≠ P227), A226 (≠ G228), P227 (= P229), F294 (≠ I294), D330 (= D327), E374 (≠ Q369), K395 (≠ V390), G396 (= G391), G399 (= G394)
- binding magnesium ion: D20 (= D23), D24 (≠ T27), V26 (≠ E29), D28 (= D31)
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
35% identity, 85% coverage: 5:450/526 of query aligns to 4:472/557 of 4h8vA
- active site: D99 (= D100), R198 (= R199), D200 (= D201), E254 (= E268), H326 (= H326), D327 (= D327)
- binding calcium ion: D22 (= D23), N24 (≠ T25), D26 (≠ T27), I28 (≠ E29), D30 (= D31)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D62), Y64 (= Y65), H104 (= H105), F164 (= F165), D200 (= D201), E254 (= E268), F256 (≠ N270), R284 (≠ D289), R291 (≠ L296), H326 (= H326), D327 (= D327), E386 (≠ D382), R414 (= R392)
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
35% identity, 85% coverage: 5:450/526 of query aligns to 4:472/557 of 2pwdA
- active site: D99 (= D100), R198 (= R199), D200 (= D201), E254 (= E268), H326 (= H326), D327 (= D327)
- binding calcium ion: D22 (= D23), N24 (≠ T25), D26 (≠ T27), I28 (≠ E29), D30 (= D31)
- binding 1-deoxynojirimycin: D61 (= D62), Y64 (= Y65), H104 (= H105), F164 (= F165), D200 (= D201), E254 (= E268), H326 (= H326), D327 (= D327), R414 (= R392)
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
35% identity, 85% coverage: 5:450/526 of query aligns to 3:471/556 of 2pwgA
- active site: D98 (= D100), R197 (= R199), D199 (= D201), E253 (= E268), H325 (= H326), D326 (= D327)
- binding calcium ion: D21 (= D23), N23 (≠ T25), D25 (≠ T27), I27 (≠ E29), D29 (= D31)
- binding castanospermine: D60 (= D62), Y63 (= Y65), H103 (= H105), F163 (= F165), D199 (= D201), E253 (= E268), D326 (= D327), R413 (= R392)
4ha1A Mutb inactive double mutant d200a-d415n in complex with isomaltulose
35% identity, 85% coverage: 5:450/526 of query aligns to 3:471/556 of 4ha1A
- active site: D98 (= D100), R197 (= R199), A199 (≠ D201), E253 (= E268), H325 (= H326), D326 (= D327)
- binding calcium ion: D21 (= D23), N23 (≠ T25), D25 (≠ T27), I27 (≠ E29), D29 (= D31)
- binding 6-O-alpha-D-glucopyranosyl-D-fructose: D60 (= D62), Y63 (= Y65), H103 (= H105), F163 (= F165), E253 (= E268), R283 (≠ D289), H325 (= H326), D326 (= D327), E385 (≠ D382), R413 (= R392)
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
35% identity, 85% coverage: 5:450/526 of query aligns to 3:471/556 of 2pweA
- active site: D98 (= D100), R197 (= R199), D199 (= D201), Q253 (≠ E268), H325 (= H326), D326 (= D327)
- binding calcium ion: D21 (= D23), N23 (≠ T25), D25 (≠ T27), I27 (≠ E29), D29 (= D31)
- binding beta-D-fructofuranose: F163 (= F165), Q253 (≠ E268), F255 (≠ N270), D326 (= D327), R413 (= R392)
- binding alpha-D-glucopyranose: D60 (= D62), Y63 (= Y65), H103 (= H105), F163 (= F165), D199 (= D201), Q253 (≠ E268), H325 (= H326), D326 (= D327), R413 (= R392)
2pwfA Crystal structure of the mutb d200a mutant in complex with glucose (see paper)
35% identity, 85% coverage: 5:450/526 of query aligns to 2:470/555 of 2pwfA
- active site: D97 (= D100), R196 (= R199), A198 (≠ D201), E252 (= E268), H324 (= H326), D325 (= D327)
- binding beta-D-glucopyranose: D59 (= D62), Y62 (= Y65), H102 (= H105), F162 (= F165), R196 (= R199), A198 (≠ D201), E252 (= E268), H324 (= H326), D325 (= D327), R412 (= R392)
- binding calcium ion: D20 (= D23), N22 (≠ T25), D24 (≠ T27), I26 (≠ E29), D28 (= D31)
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
33% identity, 92% coverage: 7:490/526 of query aligns to 3:505/546 of 8ibkA
- binding calcium ion: D19 (= D23), N21 (≠ T25), D23 (≠ T27), I25 (≠ E29), D27 (= D31)
- binding alpha-D-glucopyranose: D58 (= D62), Y61 (= Y65), H101 (= H105), I141 (≠ F145), F161 (= F165), D197 (= D201), A198 (= A202), H201 (≠ S205), M227 (≠ S230), Q254 (≠ E257), Q254 (≠ E257), F280 (= F282), H320 (= H326), D321 (= D327), R405 (= R392)
Sites not aligning to the query:
2ze0A Alpha-glucosidase gsj (see paper)
33% identity, 97% coverage: 4:512/526 of query aligns to 1:513/531 of 2ze0A
4howA The crystal structure of isomaltulose synthase from erwinia rhapontici nx5 (see paper)
33% identity, 85% coverage: 7:451/526 of query aligns to 6:474/559 of 4howA
4hphA The crystal structure of isomaltulose synthase mutant e295q from erwinia rhapontici nx5 in complex with its natural substrate sucrose (see paper)
33% identity, 85% coverage: 7:451/526 of query aligns to 6:474/559 of 4hphA
- active site: D99 (= D100), R198 (= R199), D200 (= D201), Q254 (≠ E268), H327 (= H326), D328 (= D327)
- binding calcium ion: D22 (= D23), N24 (≠ T25), D26 (≠ T27), I28 (≠ E29), D30 (= D31)
- binding beta-D-fructofuranose: F164 (= F165), Q254 (≠ E268), F256 (≠ N270), D328 (= D327), E387 (≠ D382), R415 (= R392)
- binding alpha-D-glucopyranose: D61 (= D62), Y64 (= Y65), H104 (= H105), F164 (= F165), D200 (= D201), Q254 (≠ E268), H327 (= H326), D328 (= D327), R415 (= R392)
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
30% identity, 97% coverage: 7:517/526 of query aligns to 2:537/555 of 4m56A
- active site: D95 (= D100), R195 (= R199), D197 (= D201), E250 (= E257), H326 (= H326), D327 (= D327)
- binding D-glucose: D57 (= D62), Y60 (= Y65), H100 (= H105), F142 (= F146), D197 (= D201), E250 (= E257), D327 (= D327), R413 (= R392)
4hozA The crystal structure of isomaltulose synthase mutant d241a from erwinia rhapontici nx5 in complex with d-glucose (see paper)
33% identity, 85% coverage: 7:451/526 of query aligns to 6:474/559 of 4hozA
- active site: D99 (= D100), R198 (= R199), A200 (≠ D201), E254 (= E268), H327 (= H326), D328 (= D327)
- binding calcium ion: D22 (= D23), N24 (≠ T25), D26 (≠ T27), I28 (≠ E29), D30 (= D31)
- binding alpha-D-glucopyranose: D61 (= D62), Y64 (= Y65), H104 (= H105), F164 (= F165), R198 (= R199), A200 (≠ D201), E254 (= E268), H327 (= H326), D328 (= D327), R415 (= R392)
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
31% identity, 91% coverage: 7:486/526 of query aligns to 2:509/556 of 5wczA
- active site: D95 (= D100), R195 (= R199), D197 (= D201), E250 (= E257), H326 (= H326), D327 (= D327)
- binding 1-deoxynojirimycin: D57 (= D62), Y60 (= Y65), H100 (= H105), F161 (= F165), D197 (= D201), V198 (≠ A202), E250 (= E257), H326 (= H326), D327 (= D327), R413 (= R392)
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
31% identity, 91% coverage: 7:486/526 of query aligns to 2:512/559 of 4mazA
5brpA Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png (see paper)
31% identity, 85% coverage: 5:453/526 of query aligns to 1:470/555 of 5brpA
- active site: D96 (= D100), Q196 (≠ R199), D198 (= D201), E249 (= E268), H323 (= H326), D324 (= D327)
- binding magnesium ion: D19 (= D23), T21 (= T25), N23 (≠ T27), V25 (≠ E29), D27 (= D31)
- binding 4-nitrophenyl alpha-D-glucopyranoside: D58 (= D62), N59 (≠ G63), Y61 (= Y65), H101 (= H105), Y162 (≠ F165), D198 (= D201), V199 (≠ A202), E249 (= E268)
4aieA Structure of glucan-1,6-alpha-glucosidase from lactobacillus acidophilus ncfm (see paper)
32% identity, 95% coverage: 5:506/526 of query aligns to 1:516/537 of 4aieA
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
31% identity, 91% coverage: 7:486/526 of query aligns to 2:512/559 of 7lv6B
Query Sequence
>3610517 FitnessBrowser__Dino:3610517
MPRRGPWPENPVIYQVYPRSFLDTTGTGEGDLPGVTRQLDYIAGLGVDGIWLSPFYPSPF
CDGGYDIADHCAVDRRFGTLDDFDALVARAHDLDLRVMIDLVLNHTSDTHDWFAKSLARE
EGFEDVYIWADPCKDGSPPSNWLSFFGEAAWRWHPQRAQYCLHKFLPCQPCLNHYNDRVH
ERLNRITRFWRDRGVDGFRYDAVTSFFYDPGFRDNPPAAEAEAALIPGPSNNPYTFQEHI
HDVLPNECAAFAETLREMAGPDAYLLGEINNGPRSVEVTCKFTGPDRLDAGYAIDLPERG
PSTEVLRDLLTRLEDAEGWTWWLNSHDQKRAVSSFGDGGAADAKMLAAFLCALPGPLLLF
QGEELGQPQAELEKVELTDPYDLMYWPDSVGRNGARAPMAWDDTQPACGFSKAVPWLPMA
RAEQGGVAQQEADPASVLAFYRDALARRRDLGLAEATMELEDAPDACIRFRLRVGTLVVQ
VAANMSGAPQDLAPRQGAKRILQTKPPAPGSNLPPRSAAWWLLEKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory