Comparing 3610544 FitnessBrowser__Dino:3610544 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
43% identity, 77% coverage: 44:228/240 of query aligns to 121:304/308 of O33341
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
37% identity, 94% coverage: 1:226/240 of query aligns to 6:255/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
37% identity, 93% coverage: 4:226/240 of query aligns to 4:249/249 of 7d53A
3fijA Crystal structure of a uncharacterized protein lin1909
36% identity, 73% coverage: 47:220/240 of query aligns to 42:221/224 of 3fijA
7d4rB Spua native structure (see paper)
39% identity, 92% coverage: 4:223/240 of query aligns to 2:214/215 of 7d4rB
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
37% identity, 74% coverage: 44:220/240 of query aligns to 57:243/252 of 6vtvB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
37% identity, 74% coverage: 44:220/240 of query aligns to 59:245/254 of P76038
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
34% identity, 45% coverage: 94:200/240 of query aligns to 99:192/693 of P49915
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
33% identity, 45% coverage: 94:200/240 of query aligns to 77:167/658 of 2vxoB
Sites not aligning to the query:
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
31% identity, 57% coverage: 85:221/240 of query aligns to 350:504/506 of 1vcnA
Sites not aligning to the query:
1vcoA Crystal structure of t.Th. Hb8 ctp synthetase complex with glutamine (see paper)
31% identity, 58% coverage: 85:224/240 of query aligns to 363:531/531 of 1vcoA
Sites not aligning to the query:
Q5SIA8 CTP synthase; Cytidine 5'-triphosphate synthase; Cytidine triphosphate synthetase; CTP synthetase; CTPS; UTP--ammonia ligase; EC 6.3.4.2 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 58% coverage: 85:224/240 of query aligns to 377:548/550 of Q5SIA8
Sites not aligning to the query:
1ce8B Carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp (see paper)
29% identity, 48% coverage: 86:200/240 of query aligns to 255:354/379 of 1ce8B
Sites not aligning to the query:
P0A6F1 Carbamoyl phosphate synthase small chain; Carbamoyl phosphate synthetase glutamine chain; EC 6.3.5.5 from Escherichia coli (strain K12) (see paper)
29% identity, 48% coverage: 86:200/240 of query aligns to 256:355/382 of P0A6F1
Sites not aligning to the query:
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
25% identity, 65% coverage: 46:200/240 of query aligns to 43:160/183 of 7yc6A
>3610544 FitnessBrowser__Dino:3610544
MTRPLIGVTTSSRSGWRVFPFINLNLWLTGGRGLRWGAGRPADLDKVDGIVIGGGDDISP
ELYGTEVLTTARLDPARDALEHGLAREALIRNIPVLGICRGAQMLNVAAGGSLHQNAWQV
HPTSRPVKTVLPKRMVEVQANARLALIAGTEPMRVNALHSQAVDRLGDGFRVAARDTGGM
VQAIERVEDPFALGVQWHPEYLVYARRQRAIFRALVTAARARAQHRLQTPDVTRDALTAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory