SitesBLAST
Comparing 3610733 FitnessBrowser__Dino:3610733 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h5sB Thymidylyltransferase complexed with tmp (see paper)
62% identity, 98% coverage: 1:285/290 of query aligns to 1:285/291 of 1h5sB
- binding thymidine-5'-phosphate: L9 (= L9), G11 (= G11), G12 (= G12), Q83 (= Q83), P86 (= P86), D87 (= D87), G88 (= G88), D111 (= D111), Y115 (≠ F115), G116 (= G116), H117 (= H117), D118 (≠ G118), G219 (= G219), R220 (= R220), G221 (= G221), S252 (≠ G252), E256 (= E256), I257 (= I257), R260 (≠ D260)
1h5tA Thymidylyltransferase complexed with thymidylyldiphosphate-glucose (see paper)
62% identity, 99% coverage: 4:290/290 of query aligns to 3:289/290 of 1h5tA
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L8 (= L9), G10 (= G11), Q82 (= Q83), P85 (= P86), G87 (= G88), L108 (= L109), D110 (= D111), Y145 (= Y146), G146 (= G147), E161 (= E162), K162 (= K163), V172 (= V173), R194 (= R195)
- binding thymidine-5'-diphosphate: Y114 (≠ F115), G115 (= G116), H116 (= H117), D117 (≠ G118), R219 (= R220), G220 (= G221), V250 (≠ T251), S251 (≠ G252)
1h5rA Thymidylyltransferase complexed with thimidine and glucose-1-phospate (see paper)
62% identity, 99% coverage: 4:290/290 of query aligns to 3:289/290 of 1h5rA
- binding 1-O-phosphono-alpha-D-glucopyranose: L88 (= L89), Y145 (= Y146), G146 (= G147), E161 (= E162), K162 (= K163), V172 (= V173)
- binding thymidine: L8 (= L9), G10 (= G11), G11 (= G12), Q82 (= Q83), P85 (= P86), G87 (= G88), L88 (= L89), D110 (= D111), Y114 (≠ F115), G115 (= G116), V250 (≠ T251), S251 (≠ G252), E255 (= E256), I256 (= I257)
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
61% identity, 100% coverage: 1:290/290 of query aligns to 1:290/292 of P26393
- T201 (= T201) mutation to A: Two-fold increase in the conversion of 2-acetamido-2-deoxy-alpha-D-glucopyranosyl phosphate.
- W224 (= W224) mutation to H: Is able to convert both 6-acetamido-6-deoxy-alpha-D-glucopyranosyl phosphate and alpha-D-glucopyranuronic acid 1-(dihydrogen phosphate), which are not accepted by the wild-type.
3pkpA Q83s variant of s. Enterica rmla with datp (see paper)
60% identity, 100% coverage: 1:290/290 of query aligns to 1:290/290 of 3pkpA
- binding 2'-deoxyadenosine 5'-triphosphate: G11 (= G11), G12 (= G12), S13 (= S13), G14 (= G14), T15 (= T15), R16 (= R16), K26 (= K26), Q27 (= Q27), S83 (≠ Q83), P86 (= P86), G110 (= G110), D111 (= D111)
1iinA Thymidylyltransferase complexed with udp-glucose (see paper)
60% identity, 100% coverage: 1:289/290 of query aligns to 1:289/289 of 1iinA
- binding uridine-5'-diphosphate-glucose: L9 (= L9), G11 (= G11), G12 (= G12), R16 (= R16), Q83 (= Q83), P86 (= P86), D87 (= D87), G88 (= G88), L89 (= L89), L109 (= L109), D111 (= D111), Y146 (= Y146), G147 (= G147), E162 (= E162), K163 (= K163), V173 (= V173), R195 (= R195), W224 (= W224)
1iimA Thymidylyltransferase complexed with ttp (see paper)
60% identity, 100% coverage: 1:289/290 of query aligns to 1:289/289 of 1iimA
- binding thymidine-5'-triphosphate: L9 (= L9), G11 (= G11), G12 (= G12), S13 (= S13), G14 (= G14), T15 (= T15), R16 (= R16), Q27 (= Q27), Q83 (= Q83), P86 (= P86), G88 (= G88), L89 (= L89), D111 (= D111), Y115 (≠ F115), G116 (= G116), H117 (= H117), P120 (= P120), G219 (= G219), R220 (= R220), G221 (= G221), S252 (≠ G252), E256 (= E256), I257 (= I257)
3pkpB Q83s variant of s. Enterica rmla with datp (see paper)
61% identity, 99% coverage: 4:290/290 of query aligns to 3:289/289 of 3pkpB
- binding 2'-deoxyadenosine 5'-triphosphate: G10 (= G11), G11 (= G12), S12 (= S13), G13 (= G14), T14 (= T15), R15 (= R16), K25 (= K26), Q26 (= Q27), S82 (≠ Q83), P85 (= P86), G109 (= G110), D110 (= D111)
- binding magnesium ion: D110 (= D111), D225 (= D226)
3pkqA Q83d variant of s. Enterica rmla with dgtp (see paper)
61% identity, 99% coverage: 4:290/290 of query aligns to 2:285/285 of 3pkqA
- binding 2'-deoxyguanosine-5'-triphosphate: L7 (= L9), G9 (= G11), G10 (= G12), S11 (= S13), G12 (= G14), T13 (= T15), R14 (= R16), Q25 (= Q27), D81 (≠ Q83), S83 (= S85), L107 (= L109), G108 (= G110), D109 (= D111)
- binding magnesium ion: D109 (= D111), D221 (= D226)
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
60% identity, 99% coverage: 4:289/290 of query aligns to 4:289/295 of 6n0uA
- binding 2'-deoxy-thymidine-beta-l-rhamnose: L9 (= L9), G11 (= G11), G12 (= G12), Q83 (= Q83), P86 (= P86), G88 (= G88), L89 (= L89), L109 (= L109), D111 (= D111), Y146 (= Y146), G147 (= G147), E162 (= E162), K163 (= K163), V173 (= V173), G175 (= G175), Y177 (= Y177), R195 (= R195)
1mc3A Crystal structure of rffh (see paper)
60% identity, 99% coverage: 5:290/290 of query aligns to 3:288/291 of 1mc3A
- binding magnesium ion: D109 (= D111), D224 (= D226)
- binding thymidine-5'-triphosphate: L7 (= L9), G9 (= G11), G10 (= G12), G12 (= G14), T13 (= T15), R14 (= R16), K24 (= K26), Q25 (= Q27), Q81 (= Q83), P84 (= P86), L87 (= L89), D109 (= D111)
P61887 Glucose-1-phosphate thymidylyltransferase 2; G1P-TT 2; dTDP-glucose pyrophosphorylase 2; dTDP-glucose synthase 2; EC 2.7.7.24 from Escherichia coli (strain K12) (see paper)
60% identity, 99% coverage: 5:290/290 of query aligns to 2:287/293 of P61887
- D108 (= D111) binding
- D223 (= D226) binding
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
60% identity, 99% coverage: 4:289/290 of query aligns to 2:287/293 of 5ifyA
- binding 2'-deoxy-thymidine-beta-l-rhamnose: L7 (= L9), G9 (= G11), Q81 (= Q83), P84 (= P86), G86 (= G88), L87 (= L89), D109 (= D111), Y144 (= Y146), G145 (= G147), E160 (= E162), K161 (= K163), V171 (= V173), Y175 (= Y177), R193 (= R195)
- binding 2'-deoxyuridine 5'-monophosphate: Y113 (≠ F115), G114 (= G116), H115 (= H117), D116 (≠ G118), G217 (= G219), R218 (= R220), G219 (= G221), E254 (= E256), I255 (= I257)
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
59% identity, 99% coverage: 3:289/290 of query aligns to 11:297/302 of 4b2xB
5fuhA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
59% identity, 99% coverage: 3:289/290 of query aligns to 7:293/298 of 5fuhA
- binding N-[6-amino-1-(3-bromobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl]-N-methylbenzenesulfonamide: T47 (≠ V43), L50 (= L46), Y118 (≠ F114), G120 (= G116), F123 (≠ L119), A256 (≠ G252), R264 (≠ D260), Q265 (≠ K261)
4b4bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
59% identity, 99% coverage: 3:289/290 of query aligns to 7:293/298 of 4b4bA
5fyeA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
59% identity, 99% coverage: 3:289/290 of query aligns to 5:291/296 of 5fyeA
- binding N-(6-Amino-1-(3-fluorobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbenzenesulfonamide: S44 (= S42), L48 (= L46), Y116 (≠ F114), G118 (= G116), V253 (≠ T251), A254 (≠ G252), E258 (= E256), R262 (≠ D260)
5fu0A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
59% identity, 99% coverage: 3:289/290 of query aligns to 5:291/296 of 5fu0A
- binding n-(6-amino-1-(3-methylbenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-n-methylbenzenesulfonamide: S44 (= S42), L48 (= L46), Y116 (≠ F114), Y117 (≠ F115), G118 (= G116), H122 (≠ P120), V253 (≠ T251), A254 (≠ G252), E258 (= E256), Q263 (≠ K261)
5ftvA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
59% identity, 99% coverage: 3:289/290 of query aligns to 5:291/296 of 5ftvA
- binding n-(6-amino-1-(4-bromobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-n-methylbenzenesulfonamide: S44 (= S42), L48 (= L46), Y116 (≠ F114), Y117 (≠ F115), G118 (= G116), F121 (≠ L119), V253 (≠ T251), A254 (≠ G252), E258 (= E256), R262 (≠ D260), Q263 (≠ K261)
5ftsA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
59% identity, 99% coverage: 3:289/290 of query aligns to 5:291/296 of 5ftsA
- binding N-(6-Amino-1-(2-bromobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbenzenesulfonamide: S44 (= S42), L48 (= L46), Y116 (≠ F114), G118 (= G116), H122 (≠ P120), V253 (≠ T251), A254 (≠ G252), E258 (= E256), I259 (= I257)
Query Sequence
>3610733 FitnessBrowser__Dino:3610733
MTQRKGIILAGGSGTRLYPITIGVSKQLLPIYDKPMIYYPISVLMLAGIREIAIITTPED
QAQFQRAIGDGSQWGVSFTFIVQPSPDGLAQAYILAEDFLNGAPSAMVLGDNIFFGHGLP
DIMAEADAQTAGGTVFGYHVADPERYGVVAFDSAGSVKQIIEKPEVPPSNYAVTGLYFLD
GSAPERARKVQPSARGELEITTLLEMYLADGLLSVKRMGRGYAWLDTGTHGSLLDAGNFV
RTLERRQGLQTGSPDEIAYDKGWISAEALQARAEKFRKNNYGEYLGQLLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory