SitesBLAST
Comparing 3610758 FitnessBrowser__Dino:3610758 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 77% coverage: 38:183/190 of query aligns to 32:182/203 of P07464
- S71 (= S68) binding
- N85 (≠ G82) binding in other chain; binding in other chain
- D93 (≠ T93) binding
- H115 (≠ Y115) mutation to A: Results in an 1800-fold decrease in catalytic activity.
- S142 (≠ A143) binding in other chain
- A160 (= A161) binding in other chain
- TK 165:166 (≠ RG 166:167) binding
- R180 (= R181) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; Partial
- 17 binding
- 183 binding in other chain
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
35% identity, 66% coverage: 65:189/190 of query aligns to 42:165/208 of 2xatA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
30% identity, 77% coverage: 38:183/190 of query aligns to 31:181/200 of 1krrA
- binding acetyl coenzyme *a: N84 (≠ G82), I103 (≠ F104), A104 (≠ G105), P105 (= P106), T112 (≠ A113), H114 (≠ Y115), G140 (= G142), S141 (≠ A143), N146 (≠ M148), G158 (= G160), A159 (= A161), A174 (≠ V176), P177 (= P179)
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
30% identity, 77% coverage: 38:183/190 of query aligns to 31:181/201 of 1krvA
- binding 4-nitrophenyl beta-D-galactopyranoside: S70 (= S68), Y82 (≠ S80), N84 (≠ G82), V90 (≠ W88), D92 (≠ T93), M126 (= M128)
- binding coenzyme a: A104 (≠ G105), S110 (≠ T111), T112 (≠ A113), W138 (= W140), G140 (= G142), S141 (≠ A143), N146 (≠ M148), A159 (= A161), P177 (= P179), R179 (= R181)
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
30% identity, 77% coverage: 38:183/190 of query aligns to 31:181/201 of 1kruA
- binding coenzyme a: H114 (≠ Y115), W138 (= W140), G140 (= G142), S141 (≠ A143), G158 (= G160), A159 (= A161), P177 (= P179)
- binding 1-methylethyl 1-thio-beta-D-galactopyranoside: W62 (≠ R60), S70 (= S68), Y82 (≠ S80), Y82 (≠ S80), N84 (≠ G82), V90 (≠ W88), D92 (≠ T93), L102 (= L103), H114 (≠ Y115), M126 (= M128)
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
32% identity, 69% coverage: 52:183/190 of query aligns to 74:181/190 of 5u2kA
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
35% identity, 59% coverage: 75:186/190 of query aligns to 57:167/209 of P50870
- H82 (≠ A102) mutation to A: 105-fold decrease in activity.
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
35% identity, 59% coverage: 75:186/190 of query aligns to 57:167/204 of 1mrlA
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: N81 (≠ D101), H82 (≠ A102), L93 (≠ A112), M102 (≠ S121), L108 (≠ A127)
Sites not aligning to the query:
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: 37, 39, 54, 56
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
35% identity, 59% coverage: 75:186/190 of query aligns to 57:167/203 of 3dhoA
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
35% identity, 59% coverage: 75:186/190 of query aligns to 57:167/205 of 1kk4A
- binding acetyl coenzyme *a: I69 (≠ L87), G70 (= G90), K111 (≠ E130), W121 (= W140), G123 (= G142), K124 (≠ A143), A141 (≠ G160), A142 (= A161), V147 (≠ R166), K148 (≠ G167), L155 (≠ I174), G157 (≠ V176), G158 (= G177), P160 (= P179), I164 (≠ V183)
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
35% identity, 59% coverage: 75:186/190 of query aligns to 57:167/206 of 1khrA
- binding coenzyme a: H82 (≠ A102), M84 (≠ L103), W121 (= W140), A141 (≠ G160), A142 (= A161), V147 (≠ R166), L155 (≠ I174), G157 (≠ V176), P160 (= P179), I164 (≠ V183)
- binding virginiamycin m1: A80 (= A100), N81 (≠ D101), H82 (≠ A102), L93 (≠ A112)
Sites not aligning to the query:
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
29% identity, 69% coverage: 55:185/190 of query aligns to 57:183/186 of 4isxA
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
29% identity, 71% coverage: 55:189/190 of query aligns to 31:146/290 of 4mzuB
- binding coenzyme a: F72 (≠ L103), T80 (= T111), N81 (= N118), D82 (≠ E119), K83 (≠ G120), P85 (= P122), G99 (= G142), A100 (= A143), G117 (= G160), A118 (= A161), T123 (≠ R166), K124 (≠ G167), I133 (≠ V176), R138 (= R181)
- binding magnesium ion: G58 (≠ H84), N76 (≠ E107)
- binding thymine: C38 (≠ S62), A39 (≠ P63)
Sites not aligning to the query:
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
29% identity, 68% coverage: 55:184/190 of query aligns to 31:142/294 of 4mzuF
- binding coenzyme a: N81 (= N118), D82 (≠ E119), K83 (≠ G120), G100 (= G142), A101 (= A143), L106 (≠ M148), G118 (= G160), A119 (= A161), T124 (≠ R166), K125 (≠ G167), I134 (≠ V176), N136 (≠ V178), R139 (= R181)
- binding thymine: C38 (≠ S62)
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
34% identity, 61% coverage: 75:189/190 of query aligns to 56:169/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
34% identity, 61% coverage: 75:189/190 of query aligns to 56:169/211 of 4hurA
- binding acetyl coenzyme *a: S67 (≠ T86), I68 (≠ L87), G69 (= G90), A79 (= A100), N80 (≠ D101), K110 (≠ E130), W120 (= W140), I121 (≠ L141), G122 (= G142), R123 (≠ A143), M128 (= M148), A140 (≠ G160), A141 (= A161), T146 (≠ R166), G156 (≠ V176), P159 (= P179), I163 (≠ V183), R164 (≠ G184)
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
34% identity, 61% coverage: 75:189/190 of query aligns to 56:169/206 of 6x3jA
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: H91 (vs. gap), L92 (≠ V110), M101 (≠ S121), P102 (= P122), L107 (≠ A127)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G90), A79 (= A100), H81 (≠ A102), W120 (= W140), G122 (= G142)
Sites not aligning to the query:
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: 51, 53, 55
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
34% identity, 61% coverage: 75:189/190 of query aligns to 56:169/207 of 6x3cA
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (= G99), N80 (≠ D101), H81 (≠ A102), H91 (vs. gap), L92 (≠ V110), M101 (≠ S121), P102 (= P122), L104 (≠ T124)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G90), N80 (≠ D101), H81 (≠ A102), W120 (= W140), G122 (= G142), R123 (≠ A143), M128 (= M148), A140 (≠ G160), A141 (= A161)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 17, 36, 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
34% identity, 61% coverage: 75:189/190 of query aligns to 56:169/203 of 6x3cE
- binding magnesium ion: N158 (≠ V178), P159 (= P179)
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (= G99), N80 (≠ D101), H81 (≠ A102), H91 (vs. gap), L92 (≠ V110), M101 (≠ S121), P102 (= P122)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G90), H81 (≠ A102), M83 (≠ F104), W120 (= W140), G122 (= G142), A140 (≠ G160), A141 (= A161)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
3vbjA Crystal structure of antd, an n-acyltransferase from bacillus cereus in complex with dtdp and 3-hydroxybutyryl-coa (see paper)
26% identity, 71% coverage: 53:186/190 of query aligns to 16:171/186 of 3vbjA
- binding 3-hydroxybutanoyl-coenzyme a: H61 (vs. gap), I83 (≠ N118), S84 (≠ E119), Y90 (≠ A125), D94 (= D129), F96 (vs. gap), F133 (≠ M148), G145 (= G160), A146 (= A161), K151 (≠ R166), V161 (= V176), V163 (= V178), K169 (≠ G184)
- binding thymidine-5'-diphosphate: Y31 (≠ S68), R43 (≠ S80), D45 (≠ G82), D46 (≠ A83), S51 (≠ T93)
Sites not aligning to the query:
Query Sequence
>3610758 FitnessBrowser__Dino:3610758
MSETDPHPRKKSLSYPARVLRGIGAMLDPRAWAHAVRLVNYYNYSHVIPRRSLRLGRDVR
LSPNAAFSNPERIEIGDRVSIGAHCTLWAGPGTGRIEIGADALFGPEVFVTAAGYRFNEG
SPVTAQAMDEADVVIGRDVWLGARAMVMPGARIGDGAIIGAGALVRGEIPAGAIAVGVPA
RVVGQRAADP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory