Comparing 3610760 FitnessBrowser__Dino:3610760 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
2x65B Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate. (see paper)
32% identity, 73% coverage: 5:348/474 of query aligns to 5:332/334 of 2x65B
2x65A Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate. (see paper)
32% identity, 73% coverage: 5:348/474 of query aligns to 5:332/334 of 2x65A
2x60A Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with gtp. (see paper)
32% identity, 73% coverage: 5:348/474 of query aligns to 5:332/333 of 2x60A
2x5zA Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with gdp-mannose. (see paper)
32% identity, 73% coverage: 5:348/474 of query aligns to 5:332/333 of 2x5zA
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
26% identity, 41% coverage: 3:197/474 of query aligns to 4:214/286 of 8b68A
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
26% identity, 41% coverage: 3:197/474 of query aligns to 4:214/291 of 8b6dA
>3610760 FitnessBrowser__Dino:3610760
MITPVILCGGSGTRLWPLSRKSYPKQFVPLAGVQETLFQASATRLKGPGIGLPLVVTGPD
FRFIATDQLAEMGVEQATVLIEPAARNTAPAILAAALWVEARDPDALMLVMPSDHVIPDA
AAFAATVARAEPEARAGRLVTFGIVPERAETGYGWLELSETPTEAPQPLKRFVEKPDAAT
AEAMLEAGTYLWNAGIFLFSVAALRAAFEAHQPDMLAAVSASVAGARQDLSFHRLDPAPW
AEAADISIDYAIMERADNLSVVPYHGHWSDLGGWDAVWREAGPDEDGVVTTGPASALDCE
NTLLHATAEGQEVVGLGLRDTLVVAMPDAVLVADASRAQEVRAAVETLKIKGAAQAETFP
RDHRPWGWFETLALGDRFQVKRIVVKPGAALSLQSHVHRSEHWIVVAGTAKVTVDDTTRL
ISENQSVYIPLGAVHRMDNPGKVPMVLIEVQTGAYLGEDDIIRYEDVYARDSDD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory