SitesBLAST
Comparing 3610773 FitnessBrowser__Dino:3610773 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ie0B X-ray crystal structure of 2r,3r-butanediol dehydrogenase from bacillus subtilis
58% identity, 99% coverage: 1:347/350 of query aligns to 2:344/347 of 6ie0B
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
35% identity, 93% coverage: 1:327/350 of query aligns to 4:322/342 of 4ejmA
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (= H42), H61 (= H70), E62 (= E71), C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114), R109 (≠ G118), P147 (= P157), C151 (≠ A161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G180), G172 (= G182), V173 (≠ P183), I174 (= I184), T194 (≠ E204), R195 (≠ P205), Q196 (≠ S206), K199 (≠ R209), C240 (≠ V247), E245 (≠ A252), T246 (≠ V253), L263 (≠ V270), V265 (≠ I272), I291 (≠ A296)
- binding zinc ion: C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114)
Sites not aligning to the query:
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
35% identity, 93% coverage: 1:327/350 of query aligns to 4:322/343 of 4ej6A
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (= H42), H61 (= H70), E62 (= E71), C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114), R109 (≠ G118), P147 (= P157), C151 (≠ A161)
- binding zinc ion: C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114)
Sites not aligning to the query:
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
35% identity, 97% coverage: 1:341/350 of query aligns to 9:340/350 of Q5JI69
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
35% identity, 97% coverage: 1:341/350 of query aligns to 7:338/347 of 3gfbA
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (= H42), H65 (= H70), E66 (= E71), C95 (= C100), C98 (= C103), C101 (= C106), C109 (= C114), K113 (≠ G118), P151 (= P157), A155 (= A161)
- binding nicotinamide-adenine-dinucleotide: G173 (= G180), G175 (= G182), P176 (= P183), L177 (≠ I184), S196 (≠ V203), E197 (= E204), P198 (= P205), R202 (= R209), F241 (≠ V247), S242 (≠ T248), A244 (≠ V250), L264 (≠ V270), G265 (≠ S271), L266 (≠ I272), I289 (= I291), T290 (≠ K292)
Sites not aligning to the query:
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
32% identity, 99% coverage: 3:349/350 of query aligns to 4:346/348 of 1e3jA
- active site: C38 (= C37), G39 (= G38), S40 (= S39), H43 (= H42), H63 (= H70), E64 (= E71), C93 (= C100), C96 (= C103), C99 (= C106), C107 (= C114), T111 (≠ G118), P150 (= P157), G154 (≠ A161), K341 (= K344)
- binding phosphate ion: A174 (= A181), A196 (≠ E204), R197 (≠ P205), S198 (= S206), R201 (= R209)
- binding zinc ion: C38 (= C37), H63 (= H70), E64 (= E71), C93 (= C100), C96 (= C103), C99 (= C106), C107 (= C114)
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
33% identity, 93% coverage: 20:343/350 of query aligns to 22:338/347 of 5vm2A
- active site: C39 (= C37), G40 (= G38), S41 (= S39), H44 (= H42), H65 (= H70), E66 (= E71), C95 (= C100), C98 (= C103), C101 (= C106), C109 (= C114), D113 (≠ G118), P153 (= P157), G157 (≠ A161)
- binding magnesium ion: H65 (= H70), E66 (= E71), E152 (= E156)
- binding zinc ion: C95 (= C100), C98 (= C103), C101 (= C106), C109 (= C114)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
34% identity, 97% coverage: 1:341/350 of query aligns to 9:340/348 of O58389
- C42 (= C37) binding
- T44 (≠ S39) mutation to A: Total loss of enzymatic activity.
- H67 (= H70) binding
- E68 (= E71) binding
- C97 (= C100) binding
- C100 (= C103) binding
- C103 (= C106) binding
- C111 (= C114) binding
- E152 (= E156) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I184) binding
- E199 (= E204) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R209) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ VSI 270:272) binding
- IT 291:292 (≠ IA 295:296) binding
- R294 (= R298) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
34% identity, 97% coverage: 1:341/350 of query aligns to 7:338/346 of 2dfvA
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (= H42), H65 (= H70), E66 (= E71), C95 (= C100), C98 (= C103), C101 (= C106), C109 (= C114), K113 (≠ G118), P151 (= P157), A155 (= A161)
- binding nicotinamide-adenine-dinucleotide: G175 (= G182), P176 (= P183), L177 (≠ I184), E197 (= E204), P198 (= P205), R202 (= R209), F241 (≠ V247), S242 (≠ T248), A244 (≠ V250), L264 (≠ V270), G265 (≠ S271), L266 (≠ I272), I289 (= I295), T290 (≠ A296)
- binding zinc ion: C95 (= C100), C101 (= C106), C109 (= C114)
Sites not aligning to the query:
Q96V44 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Hypocrea jecorina (Trichoderma reesei) (see paper)
35% identity, 93% coverage: 25:349/350 of query aligns to 54:375/377 of Q96V44
- DI 224:225 (≠ EP 204:205) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-362.
- A362 (≠ V337) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 224-SR-225.
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
32% identity, 94% coverage: 7:335/350 of query aligns to 9:331/351 of 3qe3A
- active site: C39 (= C37), G40 (= G38), S41 (= S39), H44 (= H42), H64 (= H70), E65 (= E71), R94 (≠ C100), D97 (≠ C103), C100 (= C106), S108 (≠ C114), F112 (≠ G118), P151 (= P157), G155 (≠ A161)
- binding glycerol: Y45 (≠ E43), F54 (= F50), T116 (≠ L122), R293 (≠ A296)
- binding zinc ion: C39 (= C37), H64 (= H70), E65 (= E71)
Sites not aligning to the query:
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
32% identity, 94% coverage: 7:335/350 of query aligns to 15:337/357 of P27867
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
31% identity, 94% coverage: 7:336/350 of query aligns to 15:338/357 of Q00796
- C45 (= C37) binding
- H70 (= H70) binding
- E71 (= E71) binding
- R110 (= R110) to P: in SORDD; results in protein aggregation
- H135 (≠ V135) to R: in SORDD; results in protein aggregation
- A153 (= A153) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I184) binding
- D204 (≠ E204) binding
- R209 (= R209) binding
- Q239 (≠ A236) to L: in dbSNP:rs1042079
- N269 (≠ E266) to T: in dbSNP:rs930337
- VGL 273:275 (≠ VSI 270:272) binding
- VFR 297:299 (≠ TIA 294:296) binding
- V322 (= V319) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pl6A Human sdh/nadh/inhibitor complex (see paper)
31% identity, 94% coverage: 7:336/350 of query aligns to 14:337/356 of 1pl6A
- active site: C44 (= C37), G45 (= G38), S46 (= S39), H49 (= H42), H69 (= H70), E70 (= E71), R99 (≠ C100), D102 (≠ C103), C105 (= C106), S113 (≠ C114), F117 (≠ G118), P156 (= P157), G160 (≠ A161)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C37), S46 (= S39), I56 (= I49), F59 (= F50), H69 (= H70), E155 (= E156), L274 (≠ I272), F297 (≠ I295)
- binding nicotinamide-adenine-dinucleotide: G181 (= G182), P182 (= P183), I183 (= I184), D203 (≠ E204), L204 (≠ P205), R208 (= R209), C249 (≠ V247), T250 (= T248), V272 (= V270), G273 (≠ S271), L274 (≠ I272), F297 (≠ I295), R298 (≠ A296)
- binding zinc ion: C44 (= C37), H69 (= H70)
Sites not aligning to the query:
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
32% identity, 94% coverage: 7:335/350 of query aligns to 13:334/354 of P07846
- C43 (= C37) binding
- Y49 (≠ F44) binding
- H67 (= H70) binding
- E68 (= E71) binding
- E153 (= E156) binding
- R296 (≠ A296) binding
- Y297 (= Y297) binding
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
31% identity, 96% coverage: 16:350/350 of query aligns to 23:357/357 of 7y9pA
A2QAC0 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) (see 2 papers)
33% identity, 91% coverage: 25:341/350 of query aligns to 43:363/386 of A2QAC0
- M70 (≠ V51) mutation to F: Abolishes enzyme activity.
- DI 213:214 (≠ EP 204:205) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-359.
- Y318 (≠ I295) mutation to F: Increases affinity for D-sorbitol.
- A359 (≠ V337) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 213-SR-214.
B6HI95 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum) (see paper)
33% identity, 91% coverage: 24:341/350 of query aligns to 41:362/385 of B6HI95
- DI 212:213 (≠ EP 204:205) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-358.
- S358 (≠ V337) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 212-SR-213.
3m6iA L-arabinitol 4-dehydrogenase (see paper)
32% identity, 93% coverage: 25:349/350 of query aligns to 37:357/358 of 3m6iA
- active site: C49 (= C37), G50 (= G38), S51 (= S39), H54 (= H42), H74 (= H70), E75 (= E71), C104 (= C100), C107 (= C103), C110 (= C106), C118 (= C114), D122 (≠ G118), P160 (= P157), A164 (= A161), K352 (= K344)
- binding nicotinamide-adenine-dinucleotide: C49 (= C37), V163 (= V160), G185 (= G182), P186 (= P183), I187 (= I184), D207 (≠ E204), R212 (= R209), C255 (≠ V247), T256 (= T248), I278 (≠ V270), G279 (≠ S271), V280 (≠ I272), R304 (≠ A296)
- binding zinc ion: C49 (= C37), H74 (= H70), C104 (= C100), C107 (= C103), C110 (= C106), C118 (= C114)
Q7SI09 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see 2 papers)
32% identity, 93% coverage: 25:349/350 of query aligns to 41:361/363 of Q7SI09
- C53 (= C37) binding
- F59 (≠ E43) mutation F->A,S,Y: No effect.
- H78 (= H70) binding
- E79 (= E71) binding
- C108 (= C100) binding
- C111 (= C103) binding
- C114 (= C106) binding
- C122 (= C114) binding
- E163 (= E156) binding
- PI 190:191 (= PI 183:184) binding
- D211 (≠ E204) binding
- DI 211:212 (≠ EP 204:205) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-348.
- R216 (= R209) binding
- I282 (≠ V270) binding
- QYR 306:308 (≠ TIA 294:296) binding
- S348 (≠ L336) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 211-SR-212.
Query Sequence
>3610773 FitnessBrowser__Dino:3610773
MKAARWHGAKDIRVEDVDEPTPGAGEVKIKVAWTGICGSDLHEFLAGPIFVPVGEDHPLS
HDKAPITMGHEYCGEITELGDGVTDLSVGDRVAIEPIFACGTCAACRDGRYNLCEKLGFV
GLSGGHGGFAAYSVVPARMLHRMPEGLSMEQGALVEPAAVALHAVRVSAFKAGDRAAVFG
AGPIGLLVVESLRIAGASKIVVVEPSETRRAKAMELGATTAVDPGAEDAVAAVQAACPGG
VEVAFEVTGVPAVLAQAIDATRYEGETLVVSIWETEASFQPNTVVLKERNIKGTIAYRNV
YPAVMDLMQQGYFQAERLVTRRIGLDDIVRDGFEALVAEKSQIKILVEAP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory