Comparing 3610805 FitnessBrowser__Dino:3610805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
36% identity, 82% coverage: 26:298/331 of query aligns to 1:269/301 of 4nq8B
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
34% identity, 88% coverage: 31:320/331 of query aligns to 4:292/301 of 4pdhA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
33% identity, 90% coverage: 24:320/331 of query aligns to 2:295/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
33% identity, 90% coverage: 24:320/331 of query aligns to 1:294/303 of 4p9kA
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
37% identity, 83% coverage: 30:303/331 of query aligns to 3:274/304 of 4xeqB
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
32% identity, 79% coverage: 50:312/331 of query aligns to 23:292/303 of 4pddA
Sites not aligning to the query:
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
32% identity, 78% coverage: 47:304/331 of query aligns to 18:274/300 of 4pf8A
Sites not aligning to the query:
Q16BC9 Solute-binding protein RD1_1052 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
34% identity, 63% coverage: 62:271/331 of query aligns to 62:270/325 of Q16BC9
4pcdA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans och 114 (rd1_1052, target efi-510238) with bound l-galactonate (see paper)
34% identity, 63% coverage: 62:271/331 of query aligns to 38:246/300 of 4pcdA
4pc9A Crystal structure of a trap periplasmic solute binding protein from rosenbacter denitrificans och 114 (rd1_1052, target efi-510238) with bound d-mannonate (see paper)
34% identity, 63% coverage: 62:271/331 of query aligns to 38:246/300 of 4pc9A
Sites not aligning to the query:
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
33% identity, 81% coverage: 53:319/331 of query aligns to 31:298/312 of 4oanA
Sites not aligning to the query:
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
28% identity, 95% coverage: 4:319/331 of query aligns to 1:315/329 of P44542
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
31% identity, 77% coverage: 62:315/331 of query aligns to 39:297/310 of 7bbrA
Sites not aligning to the query:
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
34% identity, 61% coverage: 62:263/331 of query aligns to 38:239/310 of 7bcrA
Sites not aligning to the query:
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
34% identity, 61% coverage: 62:263/331 of query aligns to 38:239/310 of 7bcpA
Sites not aligning to the query:
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
34% identity, 61% coverage: 62:263/331 of query aligns to 38:239/310 of 7bcoA
Sites not aligning to the query:
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
34% identity, 61% coverage: 62:263/331 of query aligns to 38:239/310 of 7bcnA
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
29% identity, 85% coverage: 40:319/331 of query aligns to 12:292/309 of 2v4cA
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
29% identity, 85% coverage: 40:319/331 of query aligns to 12:292/308 of 2wx9A
Sites not aligning to the query:
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
29% identity, 85% coverage: 40:319/331 of query aligns to 11:291/305 of 2cexB
Sites not aligning to the query:
>3610805 FitnessBrowser__Dino:3610805
MTHLTRRTALGLATAALLVAGTASAQDTLELRMSVESTPGASTQQILAAFRDALQAEMGD
AVAIEYFDSGTLGDEIVHMQQVRTGQLDVIPIGSDAVQLDPKFAVFDIPFLFNSRDQVAA
VLDGPIGAELDQSFQENAGLKVLGFGEIGFRHITNNVRPVVTPADLEGLKLRTPGSSTRI
MSFEMLGASPIKMNIGEVYLALQQGVIDGQENPFGNIAKWSWDEVQKYISLSRHVYTPIT
LVMNLRTYEGLTDEQRDAVHAAARVAVDSSRAYGAENDASLEAVIRERSPDVELNEIDAA
SFRDVAKAIGAEIGKTAGEAFTARFVEAASQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory