SitesBLAST
Comparing 3610814 FitnessBrowser__Dino:3610814 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
37% identity, 95% coverage: 8:271/277 of query aligns to 8:281/288 of P19920
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
37% identity, 95% coverage: 8:271/277 of query aligns to 8:281/287 of 1n5wC
7dqxE Crystal structure of xanthine dehydrogenase family protein
34% identity, 98% coverage: 1:271/277 of query aligns to 1:282/293 of 7dqxE
- binding flavin-adenine dinucleotide: K29 (≠ R29), I30 (≠ V30), I31 (≠ L31), G33 (= G33), G34 (= G34), Q35 (= Q35), S36 (= S36), L37 (= L37), H78 (= H78), I101 (= I101), A102 (= A102), I106 (= I106), G110 (= G110), T111 (= T111), G113 (= G113), G114 (= G114), S115 (≠ A115), A117 (≠ S117), A123 (= A123), E124 (= E124), I167 (≠ L167), Y193 (= Y193)
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
34% identity, 95% coverage: 8:269/277 of query aligns to 8:279/287 of 1ffuC
- binding flavin-adenine dinucleotide: K29 (≠ R29), L30 (≠ V30), A32 (= A32), G33 (= G33), G34 (= G34), H35 (≠ Q35), S36 (= S36), L37 (= L37), I54 (= I54), I101 (= I101), A102 (= A102), G110 (= G110), T111 (= T111), G114 (= G114), D115 (≠ A115), A117 (≠ S117), N123 (≠ A123), D124 (≠ E124), L161 (= L161), V166 (≠ I166), M167 (≠ L167), W193 (≠ Y193)
4zohB Crystal structure of glyceraldehyde oxidoreductase (see paper)
33% identity, 97% coverage: 1:269/277 of query aligns to 1:269/274 of 4zohB
- active site: Y256 (= Y256)
- binding flavin-adenine dinucleotide: R28 (= R29), P29 (≠ V30), A31 (= A32), G32 (= G33), G33 (= G34), H34 (≠ Q35), S35 (= S36), L36 (= L37), H77 (= H78), I95 (= I101), G96 (≠ A102), V100 (≠ I106), T105 (= T111), G108 (= G114), S109 (≠ A115), S111 (= S117), A117 (= A123), D118 (≠ E124), L160 (≠ I166), V161 (≠ L167), D185 (= D192), F186 (≠ Y193)
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
41% identity, 71% coverage: 1:196/277 of query aligns to 1:193/285 of 1t3qC
- binding flavin-adenine dinucleotide: I29 (≠ V30), A31 (= A32), G32 (= G33), G33 (= G34), Q34 (= Q35), S35 (= S36), L36 (= L37), V100 (≠ I101), A101 (= A102), V105 (≠ I106), T110 (= T111), G113 (= G114), S114 (≠ A115), A116 (≠ S117), A122 (= A123), E123 (= E124), L166 (= L167), Y190 (= Y193)
Q0QLF4 Nicotinate dehydrogenase FAD-subunit; NDH; Nicotinic acid hydroxylase FAD-subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
29% identity, 58% coverage: 30:190/277 of query aligns to 29:192/296 of Q0QLF4
- 29:36 (vs. 30:37, 50% identical) binding
- G101 (≠ A102) binding
- TIGGN 110:114 (≠ TIGGA 111:115) binding
- D123 (≠ E124) binding
- R160 (vs. gap) binding
- M169 (≠ L167) binding
- K187 (≠ E185) binding
3hrdG Crystal structure of nicotinate dehydrogenase (see paper)
29% identity, 58% coverage: 30:190/277 of query aligns to 29:192/292 of 3hrdG
- binding flavin-adenine dinucleotide: I29 (≠ V30), A31 (= A32), G32 (= G33), G33 (= G34), T34 (≠ Q35), D35 (≠ S36), F77 (≠ H78), V100 (≠ I101), G101 (≠ A102), I105 (= I106), T110 (= T111), G113 (= G114), N114 (≠ A115), S116 (= S117), T117 (≠ H118), G122 (≠ A123), D123 (≠ E124), I168 (= I166), M169 (≠ L167)
2w54A Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
28% identity, 94% coverage: 14:274/277 of query aligns to 170:440/450 of 2w54A
- binding flavin-adenine dinucleotide: L189 (≠ V30), A191 (= A32), G192 (= G33), G193 (= G34), T194 (≠ Q35), D195 (≠ S36), V196 (≠ L37), W199 (≠ A40), L213 (≠ I54), F258 (≠ I101), A259 (= A102), A267 (≠ G110), T268 (= T111), G271 (= G114), N272 (≠ A115), A274 (≠ S117), N275 (≠ H118), G280 (≠ A123), D281 (≠ E124), R318 (≠ L161), V324 (≠ L167), Q347 (≠ G191)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 63, 103, 104, 106, 134, 135, 136
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 102, 136
1jroA Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
28% identity, 94% coverage: 14:274/277 of query aligns to 170:440/450 of 1jroA
- binding flavin-adenine dinucleotide: L189 (≠ V30), A191 (= A32), G192 (= G33), G193 (= G34), T194 (≠ Q35), D195 (≠ S36), V196 (≠ L37), F258 (≠ I101), A259 (= A102), T268 (= T111), G271 (= G114), N272 (≠ A115), A274 (≠ S117), G280 (≠ A123), D281 (≠ E124), R318 (≠ L161), V324 (≠ L167)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42, 43
- binding fe2/s2 (inorganic) cluster: 37, 38, 39, 40, 42, 44, 45, 47, 63, 103, 106, 134, 136
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 77% coverage: 14:226/277 of query aligns to 270:485/1361 of Q8GUQ8
- W364 (≠ H100) mutation to A: Decreases activity 8-fold.
- Y421 (≠ V156) mutation to A: Decreases activity 4-fold.
Sites not aligning to the query:
- 831 E→A: Loss of activity.
- 909 R→A: Decreases activity 12-fold.
- 1297 E→A: Decreases activity 40-fold.
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
26% identity, 77% coverage: 8:219/277 of query aligns to 210:423/1307 of 2e1qA
- binding flavin-adenine dinucleotide: K230 (≠ R29), L231 (≠ V30), V232 (≠ L31), V233 (≠ A32), G234 (= G33), N235 (≠ G34), T236 (≠ Q35), E237 (≠ S36), I238 (≠ L37), F311 (≠ I101), A312 (= A102), V316 (≠ I106), A320 (≠ G110), S321 (≠ T111), G324 (= G114), N325 (≠ A115), I327 (≠ S117), T328 (≠ H118), S333 (≠ A123), D334 (≠ E124), I377 (= I166), L378 (= L167)
Sites not aligning to the query:
- active site: 742, 777, 855, 859, 887, 1235, 1236
- binding bicarbonate ion: 814, 815, 852, 886, 889, 890, 893
- binding calcium ion: 715, 716, 718, 741, 747, 780, 781, 784, 811, 812
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 719
- binding hydroxy(dioxo)molybdenum: 773, 774, 887, 1053, 1054, 1236
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
26% identity, 77% coverage: 8:219/277 of query aligns to 236:449/1333 of P47989
- 257:264 (vs. 30:37, 13% identical) binding
- F337 (≠ I101) binding
- SVGGN 347:351 (≠ TIGGA 111:115) binding
- D360 (≠ E124) binding
- K395 (≠ T158) to M: in dbSNP:rs34929837
- K422 (≠ E184) binding
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 584 D → A: in dbSNP:rs45491693
- 607 R → Q: in dbSNP:rs45442092
- 617 K → N: in dbSNP:rs45442398
- 623 T → I: in dbSNP:rs45448694
- 646 I → V: in dbSNP:rs17323225
- 703 I → V: in dbSNP:rs17011368
- 763 L → F: in a breast cancer sample; somatic mutation
- 791 R → G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
- 910 T → M: in dbSNP:rs669884
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
P77324 Aldehyde oxidoreductase FAD-binding subunit PaoB; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
26% identity, 81% coverage: 8:231/277 of query aligns to 6:278/318 of P77324
- 26:34 (vs. 29:37, 44% identical) binding
- T108 (= T111) binding
- C119 (≠ A122) binding
- C129 (vs. gap) binding
- C138 (vs. gap) binding
- C157 (= C128) binding
- D164 (vs. gap) binding
- I213 (≠ L167) binding
- K230 (≠ E184) binding
5g5gB Escherichia coli periplasmic aldehyde oxidase (see paper)
26% identity, 81% coverage: 8:231/277 of query aligns to 6:278/316 of 5g5gB
- binding flavin-adenine dinucleotide: K26 (≠ R29), F27 (≠ V30), A29 (= A32), G30 (= G33), G31 (= G34), T32 (≠ Q35), N33 (≠ S36), L34 (= L37), G98 (≠ I101), A99 (= A102), L103 (≠ I106), A107 (≠ G110), T108 (= T111), A110 (≠ G113), G111 (= G114), N112 (≠ A115), L114 (≠ S117), Q115 (≠ H118), S163 (vs. gap), D164 (vs. gap), L212 (≠ I166), I213 (≠ L167), F239 (≠ Y193)
- binding iron/sulfur cluster: C119 (≠ A122), C129 (vs. gap), N130 (vs. gap), K131 (vs. gap), C138 (vs. gap), H148 (vs. gap), C157 (= C128), I158 (vs. gap), A159 (vs. gap)
3unaA Crystal structure of bovine milk xanthine dehydrogenase with NAD bound (see paper)
25% identity, 84% coverage: 8:241/277 of query aligns to 206:438/1286 of 3unaA
- binding flavin-adenine dinucleotide: L227 (≠ V30), V228 (≠ L31), V229 (≠ A32), G230 (= G33), N231 (≠ G34), T232 (≠ Q35), E233 (≠ S36), I234 (≠ L37), F307 (≠ I101), A308 (= A102), A316 (≠ G110), S317 (≠ T111), G320 (= G114), N321 (≠ A115), I323 (≠ S117), T324 (≠ H118), S329 (≠ A123), D330 (≠ E124), I373 (= I166), L374 (= L167)
- binding nicotinamide-adenine-dinucleotide: P327 (= P121), Y363 (≠ V156), R364 (≠ F157), A430 (≠ L233), D431 (= D234)
Sites not aligning to the query:
- active site: 729, 764, 842, 846, 874, 1222, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 801, 802, 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148, 706
- binding nicotinamide-adenine-dinucleotide: 471, 478
3bdjA Crystal structure of bovine milk xanthine dehydrogenase with a covalently bound oxipurinol inhibitor (see paper)
25% identity, 84% coverage: 8:241/277 of query aligns to 206:438/1286 of 3bdjA
- binding flavin-adenine dinucleotide: L227 (≠ V30), V228 (≠ L31), V229 (≠ A32), G230 (= G33), N231 (≠ G34), T232 (≠ Q35), E233 (≠ S36), I234 (≠ L37), F307 (≠ I101), A308 (= A102), A316 (≠ G110), S317 (≠ T111), G320 (= G114), N321 (≠ A115), I323 (≠ S117), T324 (≠ H118), S329 (≠ A123), D330 (≠ E124), I373 (= I166), L374 (= L167)
Sites not aligning to the query:
- active site: 729, 764, 842, 846, 874, 1222, 1223
- binding Oxypurinol: 764, 842, 876, 971, 972, 1040, 1041, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 801, 802, 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148, 706
- binding Oxo(sulfanyl)molybdenum(IV) ION: 761, 872, 873, 874, 1223
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
25% identity, 84% coverage: 8:241/277 of query aligns to 208:440/1291 of 3amzA
- binding flavin-adenine dinucleotide: L229 (≠ V30), V230 (≠ L31), V231 (≠ A32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), E235 (≠ S36), I236 (≠ L37), F309 (≠ I101), A318 (≠ G110), S319 (≠ T111), G322 (= G114), N323 (≠ A115), I325 (≠ S117), T326 (≠ H118), S331 (≠ A123), D332 (≠ E124), I375 (= I166), L376 (= L167)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S328 (≠ D120), P329 (= P121), I330 (≠ A122), Y365 (≠ V156), R366 (≠ F157), D402 (= D192), I403 (≠ Y193), G430 (= G231), A432 (≠ L233), D433 (= D234)
Sites not aligning to the query:
- active site: 731, 766, 844, 848, 876, 1224, 1225
- binding bicarbonate ion: 803, 804, 873, 874, 878, 879, 882
- binding calcium ion: 831, 834, 835, 838, 871, 872
- binding flavin-adenine dinucleotide: 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 708
- binding 1,4-dihydronicotinamide adenine dinucleotide: 473, 480, 1189
- binding uric acid: 766, 844, 878, 973, 974, 1043, 1225
3am9A Complex of bovine xanthine dehydrogenase and trihydroxy fyx-051 (see paper)
25% identity, 84% coverage: 8:241/277 of query aligns to 208:440/1293 of 3am9A
- binding flavin-adenine dinucleotide: K228 (≠ R29), L229 (≠ V30), V231 (≠ A32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), E235 (≠ S36), I236 (≠ L37), F309 (≠ I101), A310 (= A102), V314 (≠ I106), A318 (≠ G110), S319 (≠ T111), G322 (= G114), N323 (≠ A115), I325 (≠ S117), T326 (≠ H118), D332 (≠ E124), L376 (= L167), K394 (≠ E184)
Sites not aligning to the query:
- active site: 733, 768, 846, 850, 878, 1226, 1227
- binding bicarbonate ion: 805, 806, 875, 876, 877, 884
- binding calcium ion: 707, 709, 802, 803, 833, 836, 837, 840, 873, 874
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 148, 710
- binding 4-[5-(2,6-dioxo-1,2,3,6-tetrahydropyridin-4-yl)-1H-1,2,4-triazol-3-yl]-6-oxo-1,6-dihydropyridine-2-carbonitrile: 614, 768, 839, 842, 846, 880, 975, 980, 1045, 1227
1n5xA Xanthine dehydrogenase from bovine milk with inhibitor tei-6720 bound (see paper)
25% identity, 84% coverage: 8:241/277 of query aligns to 208:440/1290 of 1n5xA
- binding flavin-adenine dinucleotide: L229 (≠ V30), V231 (≠ A32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), E235 (≠ S36), I236 (≠ L37), F309 (≠ I101), A310 (= A102), A318 (≠ G110), S319 (≠ T111), G322 (= G114), N323 (≠ A115), I325 (≠ S117), T326 (≠ H118), D332 (≠ E124), L376 (= L167)
Sites not aligning to the query:
- active site: 734, 769, 847, 851, 879, 1227, 1228
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 711
- binding 2-(3-cyano-4-isobutoxy-phenyl)-4-methyl-5-thiazole-carboxylic acid: 615, 738, 769, 840, 847, 881, 976, 977, 978, 981
Query Sequence
>3610814 FitnessBrowser__Dino:3610814
MKASAGGYARANDLREALDLLANADGQGRVLAGGQSLIAAMNMRLSTGDMLVDISRIAEL
AGVAEDGETLRIGALTRHAAVGADPLVKTHVPLLAEATGHIAHAAIRNRGTIGGALSHAD
PAAEFPACALALGASMEIAGPDGSRTVAAEDFFEDVFTTALAEGEILTALTVPKQRPGEA
QLIEEVARRSGDYALVGLCLVKRDAGHRVALFSVGATPILARACMARLDAGDLDGAVTAL
QGEIDPPSDTQASAAYRRHLAGVLLRRAMARLTGVPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory