SitesBLAST
Comparing 3610820 FitnessBrowser__Dino:3610820 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
45% identity, 99% coverage: 3:305/307 of query aligns to 1:302/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (= W48), R65 (= R67), N166 (= N168), S202 (≠ A204), T203 (≠ C205), F222 (≠ M224), G224 (= G226), I225 (≠ V227), T226 (= T228), G261 (= G263), T262 (= T264)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
34% identity, 86% coverage: 20:282/307 of query aligns to 4:264/290 of 5mr0D
- active site: F32 (≠ W48), G34 (= G50), K150 (≠ N168), E183 (≠ T201), L206 (≠ M224)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R67), G100 (vs. gap), L101 (vs. gap), K150 (≠ N168), Y154 (≠ K172), E183 (≠ T201), G186 (≠ A204), D187 (≠ C205), L206 (≠ M224), I209 (≠ V227), T210 (= T228), G245 (= G263), T246 (= T264)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
34% identity, 87% coverage: 16:282/307 of query aligns to 1:265/290 of 5e25A
- active site: F33 (≠ W48), G35 (= G50), K151 (≠ N168), E184 (≠ T201), L207 (≠ M224)
- binding 2-oxoglutaric acid: Y88 (≠ H104), K151 (≠ N168), T247 (= T264), A248 (≠ F265)
- binding pyridoxal-5'-phosphate: R52 (= R67), K151 (≠ N168), Y155 (≠ K172), E184 (≠ T201), G187 (≠ A204), D188 (≠ C205), L207 (≠ M224), G209 (= G226), I210 (≠ V227), T211 (= T228), G246 (= G263), T247 (= T264)
7p3tB Transaminase of gamma-proteobacterium (see paper)
33% identity, 91% coverage: 20:297/307 of query aligns to 6:282/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R67), K153 (≠ N168), R157 (≠ K172), E186 (≠ T201), S187 (≠ T202), A188 (≠ N203), A189 (= A204), S190 (≠ C205), G210 (= G226), I211 (≠ V227), T212 (= T228), T248 (= T264)
4whxA X-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
31% identity, 94% coverage: 17:306/307 of query aligns to 6:300/306 of 4whxA
6thqB Crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis with norvaline
31% identity, 93% coverage: 15:298/307 of query aligns to 4:286/301 of 6thqB
- active site: F37 (≠ W48), K156 (≠ D164), E190 (≠ T201), L214 (≠ M224)
- binding pyridoxal-5'-phosphate: R60 (= R67), K156 (≠ D164), Y161 (≠ K172), E190 (≠ T201), N195 (= N206), L214 (≠ M224), G216 (= G226), I217 (≠ V227), T218 (= T228), T254 (= T264)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: R60 (= R67), Y97 (≠ H104), K156 (≠ D164), Y161 (≠ K172), E190 (≠ T201), G193 (≠ A204), E194 (≠ C205), N195 (= N206), G216 (= G226), I217 (≠ V227), T218 (= T228), G253 (= G263), T254 (= T264), A255 (≠ F265)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
32% identity, 90% coverage: 20:294/307 of query aligns to 7:278/297 of 2ej3A
- active site: F35 (≠ W48), G37 (= G50), K150 (= K166), E184 (≠ T201), L207 (≠ M224)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (≠ A204), G246 (= G263), T247 (= T264), A248 (≠ F265)
- binding pyridoxal-5'-phosphate: R58 (= R67), K150 (= K166), Y155 (≠ S171), E184 (≠ T201), G187 (≠ A204), L207 (≠ M224), G209 (= G226), I210 (≠ V227), T211 (= T228), G246 (= G263), T247 (= T264)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
32% identity, 90% coverage: 20:294/307 of query aligns to 7:278/297 of 2eiyA
- active site: F35 (≠ W48), G37 (= G50), K150 (= K166), E184 (≠ T201), L207 (≠ M224)
- binding 4-methyl valeric acid: F35 (≠ W48), Y94 (≠ H104), T247 (= T264), A248 (≠ F265)
- binding pyridoxal-5'-phosphate: R58 (= R67), K150 (= K166), Y155 (≠ S171), E184 (≠ T201), G187 (≠ A204), E188 (≠ C205), L207 (≠ M224), G209 (= G226), I210 (≠ V227), T211 (= T228), G246 (= G263), T247 (= T264)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
32% identity, 90% coverage: 20:294/307 of query aligns to 7:278/297 of 1wrvA
- active site: F35 (≠ W48), G37 (= G50), K150 (= K166), E184 (≠ T201), L207 (≠ M224)
- binding pyridoxal-5'-phosphate: R58 (= R67), K150 (= K166), Y155 (≠ S171), E184 (≠ T201), G187 (≠ A204), L207 (≠ M224), G209 (= G226), I210 (≠ V227), T211 (= T228), T247 (= T264)
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
32% identity, 90% coverage: 20:294/307 of query aligns to 7:286/305 of 2ej0B
- active site: F35 (≠ W48), G37 (= G50), K158 (= K166), E192 (≠ T201), L215 (≠ M224)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R67), Y163 (≠ S171), E192 (≠ T201), G195 (≠ A204), E196 (≠ C205), L215 (≠ M224), G217 (= G226), I218 (≠ V227), T219 (= T228), G254 (= G263), T255 (= T264)
2ej2A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
31% identity, 90% coverage: 20:294/307 of query aligns to 7:275/294 of 2ej2A
- active site: F35 (≠ W48), G37 (= G50), K147 (= K166), E181 (≠ T201), L204 (≠ M224)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: R58 (= R67), Y94 (≠ H104), Y152 (≠ S171), E181 (≠ T201), G184 (≠ A204), E185 (≠ C205), L204 (≠ M224), G206 (= G226), I207 (≠ V227), T208 (= T228), T244 (= T264), A245 (≠ F265)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
28% identity, 85% coverage: 23:282/307 of query aligns to 7:260/283 of P19938
- Y32 (≠ W48) binding
- R51 (= R67) binding
- R99 (= R116) binding
- H101 (≠ F118) binding
- K146 (≠ N168) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (≠ T201) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (≠ M224) mutation to A: Inactivates enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3daaA Crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine (see paper)
28% identity, 85% coverage: 23:282/307 of query aligns to 6:259/277 of 3daaA
- active site: Y31 (≠ W48), V33 (≠ G50), K145 (≠ N168), E177 (≠ T201), L201 (≠ M224)
- binding n-(5'-phosphopyridoxyl)-d-alanine: Y31 (≠ W48), R50 (= R67), K145 (≠ N168), E177 (≠ T201), S180 (≠ A204), S181 (≠ C205), L201 (≠ M224), G203 (= G226), I204 (≠ V227), T205 (= T228), S240 (≠ G263), T241 (= T264)
2daaA Crystallographic structure of d-amino acid aminotransferase inactivated by d-cycloserine
28% identity, 85% coverage: 23:282/307 of query aligns to 6:259/277 of 2daaA
- active site: Y31 (≠ W48), V33 (≠ G50), K145 (≠ N168), E177 (≠ T201), L201 (≠ M224)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Y31 (≠ W48), V33 (≠ G50), R50 (= R67), R98 (= R116), H100 (≠ F118), K145 (≠ N168), E177 (≠ T201), S180 (≠ A204), S181 (≠ C205), N182 (= N206), L201 (≠ M224), G203 (= G226), I204 (≠ V227), T205 (= T228), T241 (= T264)
1daaA Crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate (see paper)
28% identity, 85% coverage: 23:282/307 of query aligns to 6:259/277 of 1daaA
- active site: Y31 (≠ W48), V33 (≠ G50), K145 (≠ N168), E177 (≠ T201), L201 (≠ M224)
- binding pyridoxal-5'-phosphate: R50 (= R67), K145 (≠ N168), E177 (≠ T201), S180 (≠ A204), S181 (≠ C205), L201 (≠ M224), G203 (= G226), I204 (≠ V227), T205 (= T228), S240 (≠ G263), T241 (= T264)
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
28% identity, 85% coverage: 23:282/307 of query aligns to 6:259/280 of 3lqsA
- active site: Y31 (≠ W48), V33 (≠ G50), K145 (≠ N168), E177 (≠ T201), L201 (≠ M224)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (≠ G50), R50 (= R67), E177 (≠ T201), S180 (≠ A204), S181 (≠ C205), N182 (= N206), L201 (≠ M224), G203 (= G226), I204 (≠ V227), T205 (= T228), S240 (≠ G263), T241 (= T264), T242 (≠ F265)
1a0gB L201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate (see paper)
28% identity, 85% coverage: 23:282/307 of query aligns to 6:259/282 of 1a0gB
- active site: Y31 (≠ W48), V33 (≠ G50), K145 (≠ N168), E177 (≠ T201), A201 (vs. gap)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R50 (= R67), K145 (≠ N168), E177 (≠ T201), S180 (≠ A204), S181 (≠ C205), G203 (= G226), I204 (≠ V227), T205 (= T228), S240 (≠ G263), T241 (= T264)
7p7xA Crystal structure of d-amino acid transaminase from haliscomenobacter hydrossis (holo form). (see paper)
27% identity, 92% coverage: 22:302/307 of query aligns to 8:279/282 of 7p7xA
- binding pyridoxal-5'-phosphate: R53 (= R67), R138 (= R157), K144 (≠ Q163), Y148 (= Y167), E177 (≠ T201), A179 (≠ N203), R180 (≠ A204), S181 (≠ C205), L200 (≠ M224), G202 (= G226), I203 (≠ V227), T204 (= T228), T240 (= T264)
- binding phosphate ion: L47 (= L61), D48 (= D62), R73 (≠ F87), Y278 (≠ H301)
8ahuA Crystal structure of d-amino acid aminotrensferase from haliscomenobacter hydrossis complexed with d-cycloserine
27% identity, 92% coverage: 22:302/307 of query aligns to 9:280/283 of 8ahuA
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: F35 (≠ W48), R54 (= R67), R139 (= R157), K145 (≠ Q163), Y149 (= Y167), E178 (≠ T201), A180 (≠ N203), R181 (≠ A204), S182 (≠ C205), L201 (≠ M224), G203 (= G226), I204 (≠ V227), T205 (= T228), S240 (≠ G263), T241 (= T264)
8raiA Crystal structure of d-amino acid transaminase from haliscomenobacter hydrossis point mutant r90i complexed with phenylhydrazine
26% identity, 92% coverage: 22:302/307 of query aligns to 8:279/282 of 8raiA
- binding [6-methyl-5-oxidanyl-4-[(2-phenylhydrazinyl)methyl]pyridin-3-yl]methyl dihydrogen phosphate: F34 (≠ W48), R53 (= R67), R138 (= R157), K144 (≠ Q163), Y148 (= Y167), E177 (≠ T201), A179 (≠ N203), R180 (≠ A204), S181 (≠ C205), N182 (= N206), L200 (≠ M224), G202 (= G226), I203 (≠ V227), T204 (= T228), T240 (= T264)
Query Sequence
>3610820 FitnessBrowser__Dino:3610820
MDTHTTHDALEDPRNADIRIYINGALKHRSEAMVSVYDSGFMLGDGMWEGLRLYDGVWAF
LDDHMDRFYNSCKAVSLDVGMDRAALFDALETTRRANDMHTDVHCRLMLTRGVKVRPFQH
PALSRSGPTLVILMEHSKPVDRLHDKGIRLATVPQVRGLPMSQDAKYNSHSKLNCVIACL
QAEQAGADEALMLDPHGFVNTTNACNFFIVRKGEVWTSTGDYCMNGVTRQKVIDLCRANG
IPVREKNYSLYEAIGADEAFLTGTFGAQTPVASIDGKPIGDGTRPVTARIQALYKALIRD
HVAAHST
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory