SitesBLAST
Comparing 3610835 FitnessBrowser__Dino:3610835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
30% identity, 95% coverage: 1:279/293 of query aligns to 3:287/294 of 5je8B
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
34% identity, 90% coverage: 4:268/293 of query aligns to 16:286/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (= L9), G22 (= G10), I23 (≠ S11), M24 (= M12), N43 (≠ D31), R44 (≠ I32), T45 (≠ A33), K48 (≠ P36), V77 (= V60), S78 (≠ L61), D82 (≠ Q65), Q85 (≠ A68), V133 (≠ I116), F244 (≠ S228), K245 (≠ S229), H248 (≠ I232), K251 (= K235)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
32% identity, 91% coverage: 4:270/293 of query aligns to 16:283/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (= L9), G22 (= G10), I23 (≠ S11), M24 (= M12), N43 (≠ D31), R44 (≠ I32), T45 (≠ A33), K48 (≠ P36), M76 (≠ A59), V77 (= V60), S78 (≠ L61), D82 (≠ Q65), Q85 (≠ A68), V133 (≠ I116), F241 (≠ S228), K242 (≠ S229), H245 (≠ I232), K248 (= K235)
- binding sulfate ion: T134 (≠ S117), G135 (= G118), K183 (= K167)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
29% identity, 96% coverage: 4:283/293 of query aligns to 41:330/335 of P29266
- D68 (= D31) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K167) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q171) mutation to Q: Decrease in activity.
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
28% identity, 94% coverage: 4:277/293 of query aligns to 3:287/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), N10 (≠ S11), M11 (= M12), Y29 (≠ A30), D30 (= D31), V31 (≠ I32), M63 (≠ L56), L64 (≠ V57), P65 (≠ I58), T95 (= T91), V120 (≠ I116), G122 (= G118), F238 (≠ S228), K245 (= K235)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
28% identity, 94% coverage: 4:277/293 of query aligns to 42:326/336 of P31937
- LP 103:104 (≠ VI 57:58) binding
- N108 (= N62) binding
- T134 (= T91) binding
- K284 (= K235) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
30% identity, 98% coverage: 1:288/293 of query aligns to 1:293/298 of P0A9V8
- QM 11:12 (≠ SM 11:12) binding
- D31 (= D31) binding
- L65 (≠ V60) binding
- T96 (= T91) binding
- G122 (≠ S117) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G118) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G119) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQMLA 170:174) binding
- K240 (= K235) binding
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
30% identity, 97% coverage: 4:288/293 of query aligns to 3:292/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), Q10 (≠ S11), M11 (= M12), F29 (≠ A30), D30 (= D31), V31 (≠ I32), M63 (≠ A59), L64 (≠ V60), V73 (= V69), S94 (≠ A90), T95 (= T91), R122 (≠ G118)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
35% identity, 89% coverage: 1:261/293 of query aligns to 1:260/289 of 2cvzC
- active site: S117 (= S117), K165 (= K167), N168 (= N170), N169 (≠ Q171)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), L9 (= L9), G10 (= G10), A11 (≠ S11), M12 (= M12), N30 (≠ D31), R31 (≠ I32), T32 (≠ A33), C62 (≠ N62), L63 (≠ A63), P64 (≠ A64), E68 (≠ A68), E71 (≠ F71), S91 (≠ T91), V116 (≠ I116), F227 (vs. gap), K234 (= K235)
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
30% identity, 97% coverage: 4:288/293 of query aligns to 3:292/294 of 6smyA
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
32% identity, 98% coverage: 1:286/293 of query aligns to 1:297/298 of Q9I5I6
- 2:31 (vs. 2:31, 47% identical) binding
- P66 (≠ N62) binding
- T96 (= T91) binding ; mutation to A: Almost abolished activity.
- S122 (= S117) mutation to A: Strongly reduced activity.
- K171 (= K167) active site
- N175 (≠ Q171) mutation to A: Strongly reduced activity.
- W214 (= W210) mutation to A: Almost abolished activity.
- Y219 (vs. gap) mutation to A: Strongly reduced activity.
- K246 (= K235) binding ; mutation to A: Almost abolished activity.
- D247 (= D236) mutation to A: Almost abolished activity.
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
32% identity, 96% coverage: 2:281/293 of query aligns to 1:290/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), H10 (≠ S11), M11 (= M12), F29 (≠ A30), D30 (= D31), L31 (≠ I32), M63 (≠ V60), L64 (= L61), P65 (≠ N62), T94 (= T91), V119 (≠ I116), G121 (= G118), F237 (≠ S228), K244 (= K235)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
30% identity, 95% coverage: 6:283/293 of query aligns to 6:287/287 of 3pefA
- binding glycerol: D67 (≠ N62), G123 (= G118), K171 (= K167), N175 (≠ Q171), M178 (≠ A174), L203 (≠ V199), G207 (≠ S203), N213 (≠ S209), A217 (≠ E213), F232 (≠ S228), H236 (≠ I232), K239 (= K235), R242 (≠ V240), R269 (≠ A265)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), I11 (≠ S11), M12 (= M12), N31 (≠ D31), R32 (≠ I32), S33 (≠ A33), K36 (≠ P36), M64 (≠ A59), L65 (≠ V60), A66 (≠ L61), A70 (≠ Q65), E73 (≠ A68), T96 (= T91), V121 (≠ I116), G123 (= G118), S124 (≠ G119), A231 (≠ R227), F232 (≠ S228), H236 (≠ I232), K239 (= K235)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
34% identity, 89% coverage: 2:261/293 of query aligns to 1:259/288 of 1wp4A
- active site: S116 (= S117), K164 (= K167), N167 (= N170), N168 (≠ Q171)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), L8 (= L9), G9 (= G10), A10 (≠ S11), M11 (= M12), N29 (≠ D31), R30 (≠ I32), T31 (≠ A33), K34 (≠ P36), C61 (≠ N62), L62 (≠ A63), P63 (≠ A64), E67 (≠ A68), S90 (≠ T91), V115 (≠ I116), T225 (≠ S228), F226 (vs. gap), K233 (= K235)
- binding sulfate ion: S116 (= S117), G117 (= G118), G118 (= G119), K164 (= K167)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
29% identity, 96% coverage: 1:280/293 of query aligns to 1:284/287 of 3pduA
- binding glycerol: R242 (≠ G238), E246 (≠ D242), E246 (≠ D242), R250 (≠ K248)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), G10 (= G10), I11 (≠ S11), M12 (= M12), N31 (≠ D31), R32 (≠ I32), N33 (≠ A33), M64 (≠ A59), L65 (≠ V60), A66 (≠ L61), A70 (≠ Q65), T96 (= T91), V121 (≠ I116), G123 (= G118), T124 (≠ G119), K171 (= K167), S231 (≠ R227), F232 (≠ S228), P233 (≠ S229), H236 (≠ I232), K239 (= K235)
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
31% identity, 96% coverage: 1:281/293 of query aligns to 1:291/295 of 3obbA
2uyyA Structure of the cytokine-like nuclear factor n-pac
24% identity, 95% coverage: 4:281/293 of query aligns to 9:290/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G10), L16 (≠ S11), M17 (= M12), N36 (≠ D31), R37 (≠ I32), T38 (≠ A33), V70 (= V60), S71 (≠ L61), A75 (≠ Q65), T101 (= T91), F237 (≠ S228), Y238 (≠ S229), Y241 (≠ I232), K244 (= K235)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
24% identity, 95% coverage: 4:281/293 of query aligns to 270:551/553 of Q49A26
- 271:285 (vs. 5:19, 40% identical) binding
- T362 (= T91) binding
- M437 (= M166) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (= P226) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K235) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
7puaFM uS11m (see paper)
30% identity, 77% coverage: 3:229/293 of query aligns to 7:254/327 of 7puaFM
Sites not aligning to the query:
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
24% identity, 95% coverage: 4:281/293 of query aligns to 269:544/546 of Q922P9
- P489 (= P226) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
Query Sequence
>3610835 FitnessBrowser__Dino:3610835
MSDVAIIGLGSMGYGMAQSLLRAGLRVYGADIAPEPMARFRAEGGLAARPEAVDILVIAV
LNAAQTEAVLFGAEGWISTLRKGGVVIACATVPPRFARDMAARCAEAGVQYLDAPISGGA
AKAAQGRLSIMASGGAEAFAAAAPALDAMAETVFELGDAPGAGSAMKAINQMLAGTHIAA
MAEAVTFGMTQGVDPAKTVEVISRCAGTSWMFENRAPHIVEGDYTPRSSVNIWPKDLGIV
LDIAAEAKFAAPLTAAALQQFMAAAGSGLGGEDDAAVAKVYARNAGLTLPGEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory