Comparing 370215 FitnessBrowser__MR1:370215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P07117 Sodium/proline symporter; Proline carrier; Proline permease; Propionate transporter from Escherichia coli (strain K12) (see 4 papers)
47% identity, 90% coverage: 1:221/246 of query aligns to 183:413/502 of P07117
7slaA Cryoem structure of sglt1 at 3.15 angstrom resolution (see paper)
38% identity, 24% coverage: 137:194/246 of query aligns to 349:406/585 of 7slaA
Sites not aligning to the query:
7sl8A Cryoem structure of sglt1 at 3.4 a resolution (see paper)
38% identity, 24% coverage: 137:194/246 of query aligns to 348:405/582 of 7sl8A
Sites not aligning to the query:
>370215 FitnessBrowser__MR1:370215
MSWTDFFQASLMLIALLIIPFAVFSRPESHAGIESIDPAMLALISDKTTMIGLLSLLAWG
LGYFGQPHILSRFMAIGTVDALPTSRRIAMSWMILSLLGALATGLAGSVYFANEPLANAE
TVFFHLAQAAFNPWIGGLLIAAILSAIMSTIDSQLLVCSSVITEDFYRKWLRPTDDRELM
MVGRMGVLAIAVIAGIIALNPENSVLNLVSYAWQDLAPLSGQSYFYRCFGSNIAAMVLSQ
ALLLVP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory