Comparing 370285 FitnessBrowser__MR1:370285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
P07117 Sodium/proline symporter; Proline carrier; Proline permease; Propionate transporter from Escherichia coli (strain K12) (see 4 papers)
54% identity, 99% coverage: 1:114/115 of query aligns to 68:181/502 of P07117
Sites not aligning to the query:
>370285 FitnessBrowser__MR1:370285
MYLGGLEEAWIGIGLVIGAWLNRLFVAKRLRIYTQLADNALTLPDFFEKRFHDKQGYLKL
VSAVTILVFFTFYASSGMVGGAILFEKVFGLDYNVALVIGSAIIVGYTFIGGFLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory