Comparing 40 a.a. (MKVHRMPKGV...) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
L8EBJ9 Cell division inhibitor MciZ; FtsZ assembly inhibitor; Mother cell inhibitor of FtsZ from Bacillus subtilis (strain 168) (see paper)
100% identity, 100% coverage: 1:40/40 of query aligns to 1:40/40 of L8EBJ9
4u39L Crystal structure of ftsz:mciz complex from bacillus subtilis
100% identity, 75% coverage: 9:38/40 of query aligns to 1:30/30 of 4u39L
>40 a.a. (MKVHRMPKGV...)
MKVHRMPKGVVLVGKAWEIRAKLKEYGRTFQYVKDWISKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory