Comparing 408375 MicrobesOnline__882:408375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
36% identity, 54% coverage: 79:184/195 of query aligns to 77:183/190 of 5u2kA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 58% coverage: 79:191/195 of query aligns to 78:190/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
37% identity, 58% coverage: 79:191/195 of query aligns to 77:189/200 of 1krrA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
37% identity, 58% coverage: 79:191/195 of query aligns to 77:189/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
37% identity, 58% coverage: 79:191/195 of query aligns to 77:189/201 of 1kruA
Sites not aligning to the query:
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
35% identity, 46% coverage: 96:185/195 of query aligns to 63:167/203 of 3dhoA
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
35% identity, 46% coverage: 96:185/195 of query aligns to 63:167/204 of 1mrlA
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
35% identity, 46% coverage: 96:185/195 of query aligns to 63:167/205 of 1kk4A
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
35% identity, 46% coverage: 96:185/195 of query aligns to 63:167/206 of 1khrA
Sites not aligning to the query:
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
35% identity, 46% coverage: 96:185/195 of query aligns to 63:167/209 of P50870
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
29% identity, 56% coverage: 79:187/195 of query aligns to 77:186/186 of 4isxA
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
28% identity, 62% coverage: 66:185/195 of query aligns to 17:166/207 of 6x3cA
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
28% identity, 62% coverage: 66:185/195 of query aligns to 17:166/211 of 4hurA
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
28% identity, 62% coverage: 66:185/195 of query aligns to 17:166/206 of 6x3jA
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
28% identity, 62% coverage: 66:185/195 of query aligns to 17:166/212 of 4husA
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
28% identity, 62% coverage: 66:185/195 of query aligns to 17:166/203 of 6x3cE
7uukC Crystal structure of aminoglycoside resistance enzyme apma, complex with tobramycin (see paper)
39% identity, 28% coverage: 131:185/195 of query aligns to 176:234/276 of 7uukC
Sites not aligning to the query:
7uunA Crystal structure of aminoglycoside resistance enzyme apma, complex with neomycin (see paper)
39% identity, 28% coverage: 131:185/195 of query aligns to 175:233/273 of 7uunA
Sites not aligning to the query:
7uujA Crystal structure of aminoglycoside resistance enzyme apma, complex with gentamicin
39% identity, 28% coverage: 131:185/195 of query aligns to 174:232/272 of 7uujA
Sites not aligning to the query:
7jm2A Crystal structure of aminoglycoside resistance enzyme apma, complex with apramycin
39% identity, 28% coverage: 131:185/195 of query aligns to 174:232/272 of 7jm2A
Sites not aligning to the query:
>408375 MicrobesOnline__882:408375
MARGVALLAAVPFYLLHRVESLVLGRERSFMGLSQLLALVPGIYGVWLRAAFYRLALRSC
PQSCAIEFMTTFVTPEAVLGRNVYIGSHCNIGLADIGDDCLIGSHVLVTSGRNVHHFDDV
ETPIRLQGGERETTRIGRDCWIGNGAVVMADVGEGCVVAAGGVVVSPLPPYSVAAGVPAR
VIRKRGEPRDEGGTP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory