Comparing 44 a.a. (MKSKLFISLS...) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
O32025 Phosphatase RapE inhibitor; Phosphatase regulator E from Bacillus subtilis (strain 168) (see 2 papers)
100% identity, 100% coverage: 1:44/44 of query aligns to 1:44/44 of O32025
>44 a.a. (MKSKLFISLS...)
MKSKLFISLSAVLIGLAFFGSMYNGEMKEASRNVTLAPTHEFLV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory