SitesBLAST
Comparing 5207536 FitnessBrowser__PV4:5207536 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q46856 Alcohol dehydrogenase YqhD; EC 1.1.1.2 from Escherichia coli (strain K12) (see paper)
57% identity, 100% coverage: 1:386/387 of query aligns to 1:386/387 of Q46856
- GGS 38:40 (= GGS 38:40) binding
- 93:99 (vs. 93:99, 86% identical) binding
- T138 (= T140) binding
- N147 (= N149) binding
- K160 (= K160) binding
- YTYT 179:182 (≠ LTFT 179:182) binding
- D194 (= D194) binding
- H198 (= H198) binding
- H267 (= H267) binding
- H281 (= H281) binding
1oj7B Structural genomics, unknown function crystal structure of e. Coli k-12 yqhd (see paper)
56% identity, 99% coverage: 3:386/387 of query aligns to 6:389/390 of 1oj7B
- binding 5,6-dihydroxy-nadp: G41 (= G38), S43 (= S40), P70 (≠ A67), N71 (= N68), G97 (= G94), G98 (= G95), S99 (= S96), D102 (= D99), T141 (= T140), L142 (= L141), T145 (= T144), S147 (= S146), G152 (≠ F151), V154 (= V153), K163 (= K160), T185 (= T182), L186 (= L183), P187 (= P184), Q190 (= Q187), H201 (= H198), H270 (= H267), H284 (= H281)
- binding zinc ion: D197 (= D194), H201 (= H198), H270 (= H267), H284 (= H281)
1oj7A Structural genomics, unknown function crystal structure of e. Coli k-12 yqhd (see paper)
56% identity, 99% coverage: 3:386/387 of query aligns to 6:389/390 of 1oj7A
- binding 5,6-dihydroxy-nadp: G41 (= G38), S43 (= S40), P70 (≠ A67), N71 (= N68), G97 (= G94), G98 (= G95), S99 (= S96), D102 (= D99), T141 (= T140), L142 (= L141), T145 (= T144), S147 (= S146), N150 (= N149), G152 (≠ F151), K163 (= K160), T185 (= T182), L186 (= L183), Q190 (= Q187), D197 (= D194), H201 (= H198), H270 (= H267), H284 (= H281)
7w9yA Crystal structure of bacillus subtilis yugj in complex with NADP and nickel (see paper)
40% identity, 94% coverage: 1:364/387 of query aligns to 3:368/389 of 7w9yA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G40 (= G37), G41 (= G38), S43 (= S40), P72 (≠ A67), N73 (= N68), G99 (= G94), G100 (= G95), S101 (= S96), T140 (= T140), L141 (= L141), T144 (= T144), K162 (= K160), T184 (= T182), V185 (≠ L183), P186 (= P184), H189 (≠ Q187), H283 (= H281)
7w9zA Crystal structure of bacillus subtilis yugj in complex with NADP and nitrate (see paper)
41% identity, 91% coverage: 3:356/387 of query aligns to 2:357/381 of 7w9zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G37 (= G37), G38 (= G38), S40 (= S40), P69 (≠ A67), G96 (= G94), G97 (= G95), S98 (= S96), D101 (= D99), T137 (= T140), L138 (= L141), T141 (= T144), N146 (= N149), G148 (≠ F151), K159 (= K160), T181 (= T182), V182 (≠ L183), P183 (= P184), H186 (≠ Q187)
- binding nitrate ion: R72 (≠ Q70), V73 (≠ Y71), S74 (≠ E72), V150 (= V153), N153 (≠ Y156), W154 (vs. gap), E155 (vs. gap), W263 (= W264), H270 (= H271), H280 (= H281)
8i29A Crystal structure of butanol dehydrogenase a (yqdh) in complex with nadh from fusobacterium nucleatum
32% identity, 90% coverage: 3:351/387 of query aligns to 2:349/384 of 8i29A
- binding cobalt (ii) ion: E205 (= E201), H271 (= H267), H285 (= H281)
- binding nicotinamide-adenine-dinucleotide: A102 (≠ G95), T142 (= T140), I143 (≠ L141), A146 (≠ T144), S148 (= S146), S151 (≠ N149), S153 (≠ F151), I155 (≠ V153), T186 (= T182), I187 (≠ L183), L191 (≠ Q187)
7fjgA Crystal structure of butanol dehydrogenase a (yqdh) in complex with partial nadh from fusobacterium nucleatum
32% identity, 90% coverage: 3:351/387 of query aligns to 2:349/384 of 7fjgA
1vljB Crystal structure of nadh-dependent butanol dehydrogenase a (tm0820) from thermotoga maritima at 1.78 a resolution
35% identity, 92% coverage: 1:357/387 of query aligns to 6:362/400 of 1vljB
- binding fe (iii) ion: D200 (= D194), H204 (= H198), H273 (= H267), H287 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G45 (= G38), S47 (= S40), P76 (≠ A67), G103 (= G94), G104 (= G95), S105 (= S96), D108 (= D99), T144 (= T140), I145 (≠ L141), T148 (= T144), T150 (≠ S146), N153 (= N149), N155 (≠ F151), K166 (vs. gap), T188 (= T182), L189 (= L183), Q193 (= Q187), H204 (= H198), H287 (= H281)
6jkpA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense in complex with NAD+ (see paper)
26% identity, 91% coverage: 4:357/387 of query aligns to 4:345/376 of 6jkpA
- binding nicotinamide-adenine-dinucleotide: F42 (= F44), G96 (= G95), D100 (= D99), T137 (= T140), T138 (≠ L141), T141 (= T144), S143 (= S146), T146 (≠ N149), S181 (≠ T182), V182 (≠ L183), P183 (= P184)
6jkoA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense (see paper)
26% identity, 91% coverage: 4:357/387 of query aligns to 4:345/376 of 6jkoA
1o2dA Crystal structure of alcohol dehydrogenase, iron-containing (tm0920) from thermotoga maritima at 1.30 a resolution (see paper)
30% identity, 76% coverage: 4:297/387 of query aligns to 2:286/359 of 1o2dA
- binding fe (iii) ion: D189 (= D194), H193 (= H198), H256 (= H267), H270 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S38 (≠ G39), S39 (= S40), E68 (≠ A67), N69 (= N68), G95 (= G94), G96 (= G95), S97 (= S96), D100 (= D99), T136 (= T140), T137 (≠ L141), T140 (= T144), S142 (= S146), Y147 (≠ F151), I149 (≠ V153), K157 (≠ P162), S177 (≠ T182), M178 (≠ L183), L182 (≠ Q187), D189 (= D194), H193 (= H198), H270 (= H281)
1vhdA Crystal structure of an iron containing alcohol dehydrogenase (see paper)
30% identity, 76% coverage: 4:297/387 of query aligns to 3:287/361 of 1vhdA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (≠ G39), S40 (= S40), E69 (≠ A67), N70 (= N68), G96 (= G94), G97 (= G95), S98 (= S96), D101 (= D99), T137 (= T140), T138 (≠ L141), T141 (= T144), S143 (= S146), T146 (≠ N149), Y148 (≠ F151), I150 (≠ V153), K158 (≠ P162), S178 (≠ T182), M179 (≠ L183), L183 (≠ Q187), D190 (= D194), H194 (= H198), H271 (= H281)
- binding zinc ion: D190 (= D194), H194 (= H198), H257 (= H267), H271 (= H281)
3zdrA Structure of the alcohol dehydrogenase (adh) domain of a bifunctional adhe dehydrogenase from geobacillus thermoglucosidasius ncimb 11955 (see paper)
28% identity, 79% coverage: 6:309/387 of query aligns to 5:317/403 of 3zdrA
6c75B Structure of iron containing alcohol dehydrogenase from thermococcus thioreducens in a monoclinic crystal form (see paper)
29% identity, 78% coverage: 10:309/387 of query aligns to 6:300/378 of 6c75B
6c75A Structure of iron containing alcohol dehydrogenase from thermococcus thioreducens in a monoclinic crystal form (see paper)
29% identity, 78% coverage: 10:309/387 of query aligns to 6:300/378 of 6c75A
- binding fe (iii) ion: D193 (= D194), H197 (= H198), H260 (= H267), H272 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S33 (≠ G38), S35 (= S40), G91 (= G94), G92 (= G95), S93 (= S96), D96 (= D99), S139 (≠ T140), T140 (≠ L141), A143 (≠ T144), S148 (≠ N149), V152 (= V153), K159 (= K160), T181 (= T182), M182 (≠ L183), P183 (= P184), V186 (≠ Q187), F251 (vs. gap), H272 (= H281)
3bfjA Crystal structure analysis of 1,3-propanediol oxidoreductase (see paper)
26% identity, 90% coverage: 4:350/387 of query aligns to 3:346/382 of 3bfjA
6scgA Structure of adhe form 1 (see paper)
27% identity, 88% coverage: 6:345/387 of query aligns to 5:354/406 of 6scgA
- binding fe (iii) ion: D204 (= D194), H208 (= H198), H274 (= H267), H288 (= H281)
- binding nicotinamide-adenine-dinucleotide: D38 (≠ G38), F40 (≠ S40), A69 (= A67), D70 (≠ N68), G96 (= G94), G97 (= G95), S98 (= S96), T148 (= T140), T149 (≠ L141), T152 (= T144), V161 (= V153), L197 (≠ Q187), H278 (= H271)
A0A0S1X9S7 Alcohol dehydrogenase; EC 1.1.1.1 from Thermococcus barophilus (see paper)
27% identity, 78% coverage: 10:309/387 of query aligns to 8:301/378 of A0A0S1X9S7
- D195 (= D194) mutation to A: Disrupts the overall structure of the enzyme. Lack of acetaldehyde reduction activity and displays weak ethanol oxidation activity.
- H199 (= H198) mutation to A: Disrupts the overall structure of the enzyme. Retains 10% of ethanol oxidation and acetaldehyde reduction activities.
- H262 (= H267) mutation to A: Disrupts the overall structure of the enzyme. Displays weak ethanol oxidation and acetaldehyde reduction activities.
- H266 (= H271) mutation to A: Disrupts the overall structure of the enzyme. Displays higher acetaldehyde reduction activity (134%) but lower ethanol oxidation activity (36%).
- H274 (= H281) mutation to A: Disrupts the overall structure of the enzyme. Retains 20% of ethanol oxidation and acetaldehyde reduction activities.
7bvpA Adhe spirosome in extended conformation (see paper)
29% identity, 75% coverage: 6:294/387 of query aligns to 454:750/869 of 7bvpA
- binding nicotinamide-adenine-dinucleotide: D487 (≠ G38), F489 (≠ S40), D519 (≠ N68), S547 (= S96), D550 (= D99), T597 (= T140), T598 (≠ L141), T601 (= T144), V610 (= V153), K619 (= K160), L646 (≠ Q187), H737 (= H281)
- binding zinc ion: D653 (= D194), H657 (= H198), H723 (= H267), H737 (= H281)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 112, 113, 139, 194, 195, 198, 212, 213, 214, 246, 335, 337, 367, 418, 419
6tqmA Escherichia coli adhe structure in its compact conformation (see paper)
29% identity, 75% coverage: 6:294/387 of query aligns to 454:750/869 of 6tqmA
- binding fe (iii) ion: D653 (= D194), H657 (= H198), H723 (= H267), H737 (= H281)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: D487 (≠ G38), L490 (≠ V41), G545 (= G94), S547 (= S96), D550 (= D99), T597 (= T140), S603 (= S146), F608 (= F151), L646 (≠ Q187), H727 (= H271)
Query Sequence
>5207536 FitnessBrowser__PV4:5207536
MLNFDYRNPTQIVFGKDRLAELDKLIPAGARVMVTYGGGSVKRFGTLDKVLSALGDRTVV
EFGGIEANPQYETLAKAAKLAREESIDFLLAVGGGSVMDGTKFIALATRFEGDSDSLLFH
GFAPVPVEADQVLPLGTIATLPATGSEMNAFGVVSYNGGKFPVNHPSIYPTFSLLDPTLT
FTLPKIQVANGVVDAFVHVLEQYATYPVDGRVQDRTAEGIMRTLIEIGPITLEEPENYNA
RANLMWSATSALNGMIGAGVPFDWTTHMIGHELTAQFGIDHAQTLAAVLPSVWRVRKIQK
HAKLLQYAERVWDITEGDEASRVDLAIDKTEQFFQQLGLKTHLRDYDIAQEQIDDIVAAL
EAHGMTALSESGDLGLDISREILQLAW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory