Comparing 5207560 Shew_0094 ABC transporter-related protein (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
34% identity, 95% coverage: 21:369/369 of query aligns to 24:369/375 of 2d62A
1g291 Malk (see paper)
39% identity, 69% coverage: 11:265/369 of query aligns to 11:263/372 of 1g291
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 67% coverage: 11:257/369 of query aligns to 25:267/378 of P69874
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
33% identity, 94% coverage: 24:369/369 of query aligns to 27:347/353 of 1vciA
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
40% identity, 58% coverage: 21:234/369 of query aligns to 44:259/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
40% identity, 58% coverage: 21:234/369 of query aligns to 44:259/382 of 7aheC
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 96% coverage: 11:366/369 of query aligns to 12:347/348 of 3d31A
7ahdC Opua (e190q) occluded (see paper)
39% identity, 58% coverage: 21:234/369 of query aligns to 44:259/260 of 7ahdC
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
40% identity, 59% coverage: 29:246/369 of query aligns to 27:242/384 of 8hplC
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
40% identity, 59% coverage: 29:246/369 of query aligns to 29:244/363 of 8hprC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
40% identity, 59% coverage: 29:246/369 of query aligns to 29:244/362 of 8hprD
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 66% coverage: 10:251/369 of query aligns to 10:254/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 66% coverage: 10:251/369 of query aligns to 10:254/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 66% coverage: 10:251/369 of query aligns to 10:254/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
35% identity, 66% coverage: 10:251/369 of query aligns to 10:254/353 of Q97UY8
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 82% coverage: 21:321/369 of query aligns to 22:314/393 of P9WQI3
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
40% identity, 55% coverage: 29:232/369 of query aligns to 27:230/240 of 4ymuJ
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 66% coverage: 18:260/369 of query aligns to 18:266/369 of P19566
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
40% identity, 55% coverage: 29:232/369 of query aligns to 28:230/241 of 4u00A
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
38% identity, 60% coverage: 18:239/369 of query aligns to 17:234/371 of 3puyA
Sites not aligning to the query:
>5207560 Shew_0094 ABC transporter-related protein (RefSeq)
MSQDVADLSCKIFQQEGIALDAEFVCKAGEVLAVVGPSGGGKSTLMRMIAGLTKPESGEI
RYGDSVWFSSESGRYLTPQQRHLGYVPQHFGLFPNMTALANVVAALDHIPKAERVARAKD
WLERVNLHGLPDRLPANLSGGQRQRVALARALAREPRVLLLDEPFSAVDRETRERLYLEL
ARLKEQLAIPVIMVTHDLNEALLLADRMILISQGTLLQQGSPREVLSRPRNEAVAKQMGL
RNLFDAHVVAQEAERQITWLRFGEHLIAGNYCEQLAIGAKVRWVIPNQGVRFNSITKGRL
CRSFNKLSITIESCLSMGETMRILASIKGVKHHLNAEVPLHFAQKMGLAPGVETEVALKS
ELIHILEND
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory