Comparing 5207679 FitnessBrowser__PV4:5207679 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
57% identity, 98% coverage: 5:382/386 of query aligns to 2:378/380 of 7rsfA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
28% identity, 77% coverage: 80:378/386 of query aligns to 72:362/366 of Q8P8J5
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 95% coverage: 12:376/386 of query aligns to 14:373/383 of 7uoiA
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
28% identity, 77% coverage: 80:378/386 of query aligns to 73:357/360 of 2f7vA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
22% identity, 95% coverage: 13:380/386 of query aligns to 10:373/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
24% identity, 87% coverage: 13:349/386 of query aligns to 14:347/380 of 5vo3A
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
24% identity, 79% coverage: 73:378/386 of query aligns to 73:395/408 of Q03154
7lgpB Dape enzyme from shigella flexneri
24% identity, 91% coverage: 13:365/386 of query aligns to 12:359/377 of 7lgpB
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
25% identity, 77% coverage: 13:309/386 of query aligns to 10:298/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
25% identity, 77% coverage: 13:309/386 of query aligns to 10:298/376 of 4o23A
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
24% identity, 89% coverage: 36:378/386 of query aligns to 35:394/407 of P37111
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
24% identity, 89% coverage: 37:378/386 of query aligns to 27:371/377 of 7t1qA
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
32% identity, 42% coverage: 13:174/386 of query aligns to 12:170/258 of 4h2kA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
30% identity, 52% coverage: 69:268/386 of query aligns to 94:297/426 of 3pfoA
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
23% identity, 88% coverage: 35:375/386 of query aligns to 23:331/341 of 5xoyA
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
26% identity, 59% coverage: 37:264/386 of query aligns to 68:288/415 of P06621
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
26% identity, 59% coverage: 37:264/386 of query aligns to 43:263/389 of 1cg2A
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
30% identity, 41% coverage: 13:171/386 of query aligns to 10:165/265 of 4op4B
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
27% identity, 52% coverage: 63:264/386 of query aligns to 4:198/392 of 7m6uB
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
28% identity, 37% coverage: 76:216/386 of query aligns to 121:278/503 of Q8C165
Sites not aligning to the query:
>5207679 FitnessBrowser__PV4:5207679
MMKTFPDIKQSFRELIATPSISALEAELDMSNQGVVTLLSQWLTDLGFDCQMQAVPDTRG
KHNLLAKIGQGRGGLLLAGHTDTVPFDEGRWSQDPFTLTEKDNRWYGLGSCDMKGFFALV
IEAVRQMPTQDFVRPLYILASADEETTMNGAKAFAQSKAIAPEYALIGEPTGLKPVYMHK
GHLAQGIRITGRSGHSSDPAKGLNAIEIMHQVIGQLLKLKQHLAEHYREEAFSVPYPTMN
FGHIHGGDAANRICGCCDLHLDIRPLPGLPLEVLEQLLTQYLAELSQRYPGSISISQLYP
GSQPFAGQADAQWSQLVAQLSNQAPEVVNYATEAPYIQQLGCQTLVWGPGSIEQAHQPDE
YLDTAYINKTVDLLKQLIYHACIKAP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory