Comparing 5207680 FitnessBrowser__PV4:5207680 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7npjB Crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine
32% identity, 99% coverage: 4:326/326 of query aligns to 4:331/344 of 7npjB
7nphC Crystal structure of mycobacterium tuberculosis argc in complex with 5-methoxy-1,3-benzoxazole-2-carboxylic acid
32% identity, 99% coverage: 4:326/326 of query aligns to 4:331/344 of 7nphC
7notA Crystal structure of mycobacterium tuberculosis argc in complex with nicotinamide adenine dinucleotide phosphate (NADP+) and 5-methoxy-3- indoleacetic acid
32% identity, 99% coverage: 4:326/326 of query aligns to 4:331/344 of 7notA
7nnrA Crystal structure of mycobacterium tuberculosis argc in complex with xanthene-9-carboxylic acid
32% identity, 99% coverage: 4:326/326 of query aligns to 4:331/344 of 7nnrA
2i3gA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis in complex with NADP+. (see paper)
32% identity, 99% coverage: 4:326/326 of query aligns to 7:334/347 of 2i3gA
2ozpA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (ttha1904) from thermus thermophilus
29% identity, 100% coverage: 2:326/326 of query aligns to 2:329/342 of 2ozpA
O50146 [LysW]-L-2-aminoadipate 6-phosphate reductase; EC 1.2.1.103 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
29% identity, 100% coverage: 2:326/326 of query aligns to 4:331/344 of O50146
5einA Crystal structure of c148a mutant of lysy from thermus thermophilus in complex with NADP+ and lysw-gamma-aminoadipic acid (see paper)
29% identity, 100% coverage: 2:326/326 of query aligns to 4:331/344 of 5einA
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/360 of 4r51A
Sites not aligning to the query:
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/359 of 4r5hA
Sites not aligning to the query:
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/359 of 4r4jA
Sites not aligning to the query:
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/359 of 3pyxB
Sites not aligning to the query:
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/361 of 3pylC
Sites not aligning to the query:
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/357 of 4r54A
Sites not aligning to the query:
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/357 of 4r41A
Sites not aligning to the query:
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/357 of 4r3nA
Sites not aligning to the query:
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/357 of 3q1lA
Sites not aligning to the query:
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/357 of 3pwsA
Sites not aligning to the query:
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/357 of 3pwkA
Sites not aligning to the query:
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
24% identity, 59% coverage: 3:195/326 of query aligns to 3:167/357 of 2gz3A
Sites not aligning to the query:
>5207680 FitnessBrowser__PV4:5207680
MKSIAIIGASGYTGAQVTSLIQADDQLKIQGLYVSENSLDKGKTLASLYPVYSHIDLSLA
PLTEQAKQAIVNEADAVVLATDHGVSLHLAAWFYQAGLAVFDLSGAYRFADSEQYPKWYG
FEHIYPEVLAEAVYGLAEWNTEAIAASKMIAVPGCYPTASLTALKPLKDLMTDSLPVINA
VSGVTGAGRKAQLHTSFCEVSLTPYGVLGHRHQPEIATQLGQQVIFTPHLGNFKRGILAT
ITVQMKPGVSEADIAKAYEVYESAPLVNVYHNQFPKVDDVVHTPNCLLGWKYDPLNGYLV
VASAIDNLMKGAASQAHQCIKIHFNY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory