Comparing 5207681 FitnessBrowser__PV4:5207681 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x2wA Acetylglutamate kinase from escherichia coli bound to n-acetyl-l- glutamyl-5-phosphate (see paper)
50% identity, 97% coverage: 8:259/261 of query aligns to 5:257/258 of 2x2wA
1oh9A Acetylglutamate kinase from escherichia coli complexed with mgadp, n- acetyl-l-glutamate and the transition-state mimic alf4- (see paper)
50% identity, 97% coverage: 8:259/261 of query aligns to 5:257/258 of 1oh9A
1gs5A N-acetyl-l-glutamate kinase from escherichia coli complexed with its substrate n-acetylglutamate and its substrate analog amppnp (see paper)
50% identity, 97% coverage: 8:259/261 of query aligns to 5:257/258 of 1gs5A
P0A6C8 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Escherichia coli (strain K12) (see 4 papers)
50% identity, 97% coverage: 8:259/261 of query aligns to 5:257/258 of P0A6C8
Sites not aligning to the query:
3t7bB Crystal structure of n-acetyl-l-glutamate kinase from yersinia pestis
48% identity, 96% coverage: 8:258/261 of query aligns to 5:256/258 of 3t7bB
4usjB N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii (see paper)
35% identity, 93% coverage: 6:248/261 of query aligns to 20:265/281 of 4usjB
Sites not aligning to the query:
Q9SCL7 Acetylglutamate kinase, chloroplastic; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; AtNAGK; EC 2.7.2.8 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
35% identity, 93% coverage: 6:248/261 of query aligns to 86:331/347 of Q9SCL7
Sites not aligning to the query:
2rd5B Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana (see paper)
35% identity, 93% coverage: 6:248/261 of query aligns to 22:267/283 of 2rd5B
Sites not aligning to the query:
2btyA Acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine (see paper)
34% identity, 85% coverage: 6:228/261 of query aligns to 22:246/282 of 2btyA
Sites not aligning to the query:
Q9X2A4 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
34% identity, 85% coverage: 6:228/261 of query aligns to 22:246/282 of Q9X2A4
Sites not aligning to the query:
2v5hB Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 (see paper)
32% identity, 93% coverage: 6:248/261 of query aligns to 23:267/289 of 2v5hB
2bufA Arginine feed-back inhibitable acetylglutamate kinase (see paper)
31% identity, 85% coverage: 6:228/261 of query aligns to 27:255/292 of 2bufA
Q9HTN2 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
31% identity, 85% coverage: 6:228/261 of query aligns to 28:264/301 of Q9HTN2
Sites not aligning to the query:
2bufC Arginine feed-back inhibitable acetylglutamate kinase (see paper)
31% identity, 85% coverage: 6:228/261 of query aligns to 27:263/298 of 2bufC
2bufK Arginine feed-back inhibitable acetylglutamate kinase (see paper)
31% identity, 85% coverage: 6:228/261 of query aligns to 27:240/273 of 2bufK
3l86A The crystal structure of smu.665 from streptococcus mutans ua159
29% identity, 87% coverage: 5:232/261 of query aligns to 2:229/245 of 3l86A
4ab7H Crystal structure of a tetrameric acetylglutamate kinase from saccharomyces cerevisiae complexed with its substrate n- acetylglutamate (see paper)
27% identity, 88% coverage: 9:237/261 of query aligns to 21:247/422 of 4ab7H
3zzhC Crystal structure of the amino acid kinase domain from saccharomyces cerevisiae acetylglutamate kinase in complex with its feed- back inhibitor l-arginine (see paper)
27% identity, 88% coverage: 9:237/261 of query aligns to 39:265/288 of 3zzhC
Sites not aligning to the query:
3s6hA Crystal structure of native mmnags/k (see paper)
29% identity, 83% coverage: 5:221/261 of query aligns to 34:247/436 of 3s6hA
Sites not aligning to the query:
4kztA Structure mmnags bound with l-arginine (see paper)
29% identity, 83% coverage: 5:221/261 of query aligns to 30:243/431 of 4kztA
Sites not aligning to the query:
>5207681 FitnessBrowser__PV4:5207681
MSANKKTLVLKVGGALMQCEMGLARLMASAANIIKSGQSVILVHGGGCLVDEQLKANGME
TVKLDGLRVTPEEQVPIVVGALAGTSNKILQASAIKAGITSVGMSLCDGAIVNGSIKDEQ
LGFVGEVSPNDPTYLNFLLAQGWMPIVSSIAVDDAGNLLNVNADQAATVIAKLVEGQLVL
LSDVSGVLDGKGQLIKTLDKAHADELTKLGVIEKGMKVKVEAALEVAQWMGQPVQVASWR
DAEQLSALEKGESIGTQVMPH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory