SitesBLAST
Comparing 5207692 FitnessBrowser__PV4:5207692 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
65% identity, 99% coverage: 1:355/358 of query aligns to 1:355/361 of Q9KNV2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
65% identity, 99% coverage: 1:355/358 of query aligns to 2:354/360 of 3okfA
- active site: R120 (= R119), K142 (= K141), E184 (= E183), K226 (= K225), R238 (= R239), N242 (= N243), H245 (= H246), H249 (= H250), H262 (= H263)
- binding nicotinamide-adenine-dinucleotide: N42 (= N42), L48 (= L48), D71 (= D70), E73 (= E72), K76 (= K75), G104 (= G103), G105 (= G104), V106 (= V105), D109 (= D108), T129 (= T128), T130 (= T129), L132 (= L131), D136 (= D135), T172 (= T171), L173 (= L172), E177 (= E176)
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
60% identity, 99% coverage: 1:356/358 of query aligns to 2:359/363 of 6llaB
- active site: R121 (= R119), K143 (= K141), E185 (= E183), K227 (= K225), E237 (= E235), R242 (= R239), N246 (= N243), H249 (= H246), H253 (= H250), H266 (= H263)
- binding magnesium ion: E185 (= E183), H249 (= H246), H266 (= H263)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ I45), D72 (= D70), E74 (= E72), K77 (= K75), G105 (= G103), G106 (= G104), V107 (= V105), D110 (= D108), T130 (= T128), T131 (= T129), L133 (= L131), D137 (= D135), K143 (= K141), T173 (= T171), L174 (= L172), E178 (= E176)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
60% identity, 99% coverage: 1:356/358 of query aligns to 2:355/357 of 6lk2A
- active site: R121 (= R119), K143 (= K141), E185 (= E183), K227 (= K225), R238 (= R239), N242 (= N243), H245 (= H246), H249 (= H250), H262 (= H263)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D135), E185 (= E183), K227 (= K225), R238 (= R239), N242 (= N243), H245 (= H246), T246 (= T247), H249 (= H250), H262 (= H263)
- binding magnesium ion: E185 (= E183), H245 (= H246), H262 (= H263)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ I45), D72 (= D70), E74 (= E72), K77 (= K75), G105 (= G103), G106 (= G104), V107 (= V105), D110 (= D108), T130 (= T128), T131 (= T129), L133 (= L131), D137 (= D135), S138 (= S136), C170 (= C168), T173 (= T171), L174 (= L172), P175 (= P173), E178 (= E176)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
52% identity, 98% coverage: 4:355/358 of query aligns to 84:439/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
52% identity, 98% coverage: 4:355/358 of query aligns to 4:359/365 of 3zokA
- active site: R122 (= R119), K144 (= K141), E186 (= E183), K228 (= K225), E238 (= E235), R242 (= R239), N246 (= N243), H249 (= H246), H253 (= H250), H266 (= H263)
- binding glycine: K144 (= K141), K228 (= K225), R242 (= R239)
- binding nicotinamide-adenine-dinucleotide: T44 (= T44), V45 (≠ I45), D73 (= D70), E75 (= E72), K78 (= K75), G106 (= G103), G107 (= G104), V108 (= V105), D111 (= D108), T131 (= T128), T132 (= T129), M134 (≠ L131), D138 (= D135), S139 (= S136), K144 (= K141), K153 (= K150), T174 (= T171), L175 (= L172), E179 (= E176), H266 (= H263)
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
50% identity, 99% coverage: 1:355/358 of query aligns to 2:349/355 of 5eksA
- active site: R120 (= R119), K142 (= K141), E184 (= E183), K226 (= K225), R237 (= R239), N241 (= N243), H244 (= H246), H248 (= H250), H261 (= H263)
- binding magnesium ion: E184 (= E183), H244 (= H246), H261 (= H263)
- binding nicotinamide-adenine-dinucleotide: N42 (= N42), V45 (≠ I45), D71 (= D70), E73 (= E72), K76 (= K75), G104 (= G103), G105 (= G104), V106 (= V105), D109 (= D108), T129 (= T128), T130 (= T129), D136 (= D135), S137 (= S136), K142 (= K141), T172 (= T171), L173 (= L172), E177 (= E176)
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
48% identity, 91% coverage: 31:357/358 of query aligns to 31:359/359 of Q5NFS1
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
47% identity, 91% coverage: 31:357/358 of query aligns to 34:354/354 of 5hvnA
- active site: R123 (= R119), K145 (= K141), E187 (= E183), K228 (= K225), R239 (= R239), N243 (= N243), H246 (= H246), H250 (= H250), H263 (= H263)
- binding nicotinamide-adenine-dinucleotide: N45 (= N42), L51 (= L48), D73 (= D70), E75 (= E72), K78 (= K75), G107 (= G103), G108 (= G104), V109 (= V105), D112 (= D108), T132 (= T128), T133 (= T129), L135 (= L131), D139 (= D135), K145 (= K141), F172 (≠ C168), T175 (= T171), L176 (= L172), E180 (= E176)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
40% identity, 100% coverage: 1:357/358 of query aligns to 1:341/343 of P56081
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
40% identity, 94% coverage: 2:339/358 of query aligns to 11:366/1555 of 6hqvA
- active site: R123 (= R119), K145 (= K141), E187 (= E183), K243 (= K225), E253 (= E235), R257 (= R239), N261 (= N243), H264 (= H246), H268 (= H250), H280 (= H263)
- binding glutamic acid: D139 (= D135), K145 (= K141), E187 (= E183), K243 (= K225), R257 (= R239), H264 (= H246), H280 (= H263)
- binding nicotinamide-adenine-dinucleotide: D42 (≠ N42), N44 (≠ T44), L45 (≠ I45), E76 (= E72), K79 (= K75), G107 (= G103), G108 (= G104), V109 (= V105), D112 (= D108), T132 (= T128), T133 (= T129), L135 (= L131), D139 (= D135), S140 (= S136), K145 (= K141), K154 (= K150), T175 (= T171), L176 (= L172), P177 (= P173), E180 (= E176), H280 (= H263)
- binding zinc ion: E187 (= E183), H264 (= H246), H280 (= H263)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
38% identity, 99% coverage: 4:357/358 of query aligns to 1:306/308 of 3clhA
- active site: R107 (= R119), K129 (= K141), E171 (= E183), K207 (= K225), R212 (= R239), N216 (= N243), H219 (= H246), H223 (= H250), H236 (= H263)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ T44), V34 (≠ I45), H38 (≠ Y49), S58 (≠ D70), E60 (= E72), K63 (= K75), G91 (= G103), G92 (= G104), V93 (= V105), D96 (= D108), T116 (= T128), T117 (= T129), L119 (= L131), D123 (= D135), A124 (≠ S136), K129 (= K141), N139 (= N151), T159 (= T171), L160 (= L172), E164 (= E176)
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
42% identity, 84% coverage: 38:338/358 of query aligns to 37:362/381 of 1dqsA
- active site: R127 (= R119), K149 (= K141), E191 (= E183), K240 (= K225), E250 (= E235), R254 (= R239), N258 (= N243), H261 (= H246), H265 (= H250), H277 (= H263)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D135), K149 (= K141), N159 (= N151), E191 (= E183), K240 (= K225), R254 (= R239), L257 (= L242), N258 (= N243), H261 (= H246), H265 (= H250), H277 (= H263), K346 (= K322)
- binding nicotinamide-adenine-dinucleotide: D41 (≠ N42), N43 (≠ T44), I44 (= I45), E78 (= E72), K81 (= K75), G111 (= G103), G112 (= G104), V113 (= V105), D116 (= D108), T136 (= T128), T137 (= T129), L139 (= L131), D143 (= D135), S144 (= S136), K158 (= K150), T179 (= T171), P181 (= P173), E184 (= E176), H277 (= H263)
- binding zinc ion: E191 (= E183), H261 (= H246), H277 (= H263)
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
41% identity, 84% coverage: 38:338/358 of query aligns to 38:370/391 of 1nvbB
- active site: R128 (= R119), K150 (= K141), E192 (= E183), K248 (= K225), E258 (= E235), R262 (= R239), N266 (= N243), H269 (= H246), H273 (= H250), H285 (= H263)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D135), K150 (= K141), N160 (= N151), E192 (= E183), K248 (= K225), R262 (= R239), L265 (= L242), N266 (= N243), H269 (= H246), H273 (= H250), K354 (= K322)
- binding zinc ion: E192 (= E183), H269 (= H246), H285 (= H263)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
41% identity, 84% coverage: 38:338/358 of query aligns to 40:372/1583 of P07547
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
39% identity, 84% coverage: 40:339/358 of query aligns to 57:366/385 of 6c5cA
- active site: R130 (= R119), K152 (= K141), E194 (= E183), K246 (= K225), E254 (= E233), R258 (= R239), N262 (= N243), H265 (= H246), H269 (= H250), H281 (= H263)
- binding nicotinamide-adenine-dinucleotide: E83 (= E72), K86 (= K75), G114 (= G103), G115 (= G104), V116 (= V105), D119 (= D108), T139 (= T128), T140 (= T129), D146 (= D135), S147 (= S136), F179 (≠ C168), T182 (= T171), L183 (= L172), Q187 (≠ E176)
Sites not aligning to the query:
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
36% identity, 94% coverage: 3:338/358 of query aligns to 2:330/354 of Q6GGU4
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
36% identity, 94% coverage: 3:338/358 of query aligns to 2:330/353 of 1xagA
- active site: R115 (= R119), K136 (= K141), E178 (= E183), K221 (= K225), E231 (= E235), R235 (= R239), N239 (= N243), H242 (= H246), H246 (= H250), H256 (= H263)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K141), N146 (= N151), E178 (= E183), K221 (= K225), R235 (= R239), L238 (= L242), N239 (= N243), H242 (= H246), H246 (= H250), K314 (= K322)
- binding nicotinamide-adenine-dinucleotide: D39 (≠ N42), Y41 (≠ T44), V42 (≠ I45), Y45 (≠ L48), E68 (= E72), K71 (= K75), G99 (= G103), G100 (= G104), A101 (≠ V105), D104 (= D108), T124 (= T128), T125 (= T129), L127 (= L131), D130 (= D135), S131 (= S136), K136 (= K141), K145 (= K150), T166 (= T171), L167 (= L172), Q171 (≠ E176), H256 (= H263)
- binding zinc ion: E178 (= E183), H242 (= H246), H256 (= H263)
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
43% identity, 74% coverage: 68:333/358 of query aligns to 71:334/362 of P9WPX9
Sites not aligning to the query:
1nvaA Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp (see paper)
40% identity, 84% coverage: 38:338/358 of query aligns to 37:360/380 of 1nvaA
- active site: R127 (= R119), K149 (= K141), E191 (= E183), K247 (= K225), R257 (= R239), N261 (= N243), H264 (= H246), H268 (= H250), H280 (= H263)
- binding adenosine-5'-diphosphate: D41 (≠ N42), N43 (≠ T44), G111 (= G103), G112 (= G104), T136 (= T128), T137 (= T129), F176 (≠ C168), T179 (= T171), L180 (= L172)
- binding zinc ion: E191 (= E183), H264 (= H246), H280 (= H263)
Query Sequence
>5207692 FitnessBrowser__PV4:5207692
MEQIQVELGVRSYPIFIGQNLLENSDYFSSYLQGKKILIVTNDTIAPLYLAKVQALLASY
QCADPVILPDGEQYKTLSQMDAIFTSLLAQNMGRDSVLIALGGGVIGDMTGFAAACYQRG
VDFIQIPTTLLSQVDSSVGGKTAVNHPMGKNMIGAFYQPKMVAIDTACLHTLPAREFAAG
MAEVIKYGIIWDGSFFSWLEQNVAALKSLDEAALTYAIAKCCQIKADVVAQDETEQGVRA
LLNLGHTFGHAIEAEMGYGVWLHGEAVAAGTVLAAQTASKMGLVDQSIVCRIEAIFEAFD
LPTEAPEAMDFEQFIKHMRRDKKVLNGKLRLVLPKAIGQAEVYGEVSESLLQEVISRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory