Comparing 5207771 FitnessBrowser__PV4:5207771 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
P9WKJ5 Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 98% coverage: 3:608/616 of query aligns to 18:573/575 of P9WKJ5
6ovtA Crystal structure of ilvd from mycobacterium tuberculosis (see paper)
39% identity, 98% coverage: 3:608/616 of query aligns to 5:560/562 of 6ovtA
Q9LIR4 Dihydroxy-acid dehydratase, chloroplastic; AthDHAD; DAD; EC 4.2.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 98% coverage: 6:610/616 of query aligns to 57:607/608 of Q9LIR4
8hs0A The mutant structure of dhad v178w
36% identity, 98% coverage: 6:610/616 of query aligns to 19:569/570 of 8hs0A
8imuA Dihydroxyacid dehydratase (dhad) mutant-v497f
35% identity, 98% coverage: 6:610/616 of query aligns to 16:522/523 of 8imuA
B5ZZ34 L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 from Rhizobium leguminosarum bv. trifolii (strain WSM2304) (see 2 papers)
32% identity, 99% coverage: 3:613/616 of query aligns to 10:567/579 of B5ZZ34
5j85A Ser480ala mutant of l-arabinonate dehydratase (see paper)
32% identity, 99% coverage: 3:613/616 of query aligns to 7:564/576 of 5j85A
8epzA Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mn
32% identity, 90% coverage: 19:574/616 of query aligns to 20:527/569 of 8epzA
8ej0A Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mg
32% identity, 90% coverage: 19:574/616 of query aligns to 19:526/568 of 8ej0A
Q1JUQ1 L-arabonate dehydratase; L-arabinonate dehydratase; EC 4.2.1.25 from Azospirillum brasilense (see paper)
31% identity, 92% coverage: 3:568/616 of query aligns to 7:529/583 of Q1JUQ1
7m3kA Crystal structure of galactonate dehydratase from brucella melitensis biovar abortus 2308
29% identity, 90% coverage: 33:585/616 of query aligns to 37:559/587 of 7m3kA
Q9A9Z2 D-xylonate dehydratase; XyDHT; Gluconate dehydratase; EC 4.2.1.82; EC 4.2.1.39 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see 2 papers)
31% identity, 87% coverage: 33:570/616 of query aligns to 48:547/595 of Q9A9Z2
5oynA Crystal structure of d-xylonate dehydratase in holo-form (see paper)
31% identity, 87% coverage: 33:570/616 of query aligns to 42:541/589 of 5oynA
>5207771 FitnessBrowser__PV4:5207771
MAKLRSATSTQGRNMAGARALWRATGVKDSDFGKPIVAIANSFTQFVPGHVHLKDMGSLV
AGAIEEAGGIAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADALVCIS
NCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTKLSDKLIKLDLVDAMVAAADDRVSDED
SEKIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSLLATHSDRRELFLEAGRRVM
ALANRYYRDDDESALPRNIASFKAFENAMALDIAMGGSSNTVLHLLAAAQEAKVDFTMAD
IDRLSRQVPHLCKVAPSTPKYHMEDVHRAGGVMGILGELDRAGLLHTDVSHVAGENLKAV
LVQYDLVQTQDEAVQQFYAAGPAGIPTTKAFSQSCRWPSLDVDRQEGCIRTREFAFSQEG
GLAVLSGNIAADGCIVKTAGVDEANHTFVGHARVYESQDDAVAGILGGEVVAGDVVVIRY
EGPKGGPGMQEMLYPTSYLKSKGLGTSCALITDGRFSGGTSGLSIGHVSPEAAAGGTIAL
VETGDRIEIDIPARSITLAVSDEVLETRRQAMQARGKQAWKPVNRERSVSLALKAYAMLA
TSADKGAVRDVSKLED
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory